DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkd2 and brv2

DIOPT Version :8

Sequence 1:NP_609561.2 Gene:Pkd2 / 34651 FlyBaseID:FBgn0041195 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_648970.2 Gene:brv2 / 39932 FlyBaseID:FBgn0036712 Length:736 Species:Drosophila melanogaster

Alignment Length:777 Identity:155/778 (20%)
Similarity:284/778 (37%) Gaps:199/778 (26%)


  Fly   192 KSVGSSTPPSPSRGHRA----PSI------------IAASALQNRAKTNRILYTTDEEVREALVE 240
            :|:..:|.|.....:||    |::            :.:..|.:...||.:|....:.:...|:.
  Fly    67 QSIDYATWPQEDPPYRAEEGGPTMDHIGYLKIRLRSLRSELLISEGHTNEMLNQKYKHIAGDLLL 131

  Fly   241 FSVFIIFLILTSLVVLSVRHTYMFYFNDTMKKLFTNREMVVAPSVTVGFEKLITVPDWWDYLKYN 305
            :..:.|.|:|  :|||...|| .:|..:.|::||.:.     .|||.|..::..:.....|:|  
  Fly   132 YGSYFIALML--MVVLQEDHT-NYYNTNNMQRLFWDN-----TSVTFGLSQVYFIYQVHSYMK-- 186

  Fly   306 FLVTLHGDLTFMDDAQANLTSMPPEG---SEQGSEQGSEQGSEQSPEEV-VGEAPEE------AP 360
                    :|.::...|..|: ..||   .||..:.|..:..:..|.:. :|....|      ||
  Fly   187 --------ITLVEAFYAQKTN-GYEGWWAMEQWQKIGVVRLRQMRPVDCHIGLGKPEWDKKTYAP 242

  Fly   361 EMDRLQEDFKYNGNPYIDLRGHRRAKRQSGVDGNSEDGSEDVSGNYLKDDSDSIQANMSFHHLEG 425
            |. ||         ||     ||                                    .|:.|.
  Fly   243 EW-RL---------PY-----HR------------------------------------MHYTEK 256

  Fly   426 RVFLYENLLLGPPRLRQIRVRKESCYVNDAFIRYFNTCYAAYSSGAEDRKPMHKGSPFRTMHDLD 490
            ...:|:..         :....|..::|...:.|.:..|                          
  Fly   257 FWRIYDPF---------VPAEFEPSFLNGLLLNYDHYGY-------------------------- 286

  Fly   491 STPIWTVLAFYRTGGYTVNLDYDKDRNVKIINDLKDIHWLDRGSRLCLVEFNLFNENTDIFQSIK 555
                  :|.:....||.|.:...|...:|.|..|:|..|||:.:....::..::|.:.::|..|.
  Fly   287 ------LLNYPEVAGYVVLMMSTKINCLKQIEYLRDYSWLDKNTSALFIDLTMYNADANLFTLIT 345

  Fly   556 LIAEIPPTGGVIPQAHLQTVKMYSFFTDRSMLMTVIYIFWYIMVIYYTIYEITEIRKSGIKIYFC 620
            |..|..|.|..:|:.|:.:|.|......||....:|...:.::||.:.....|:|.......:  
  Fly   346 LRVENSPFGIQLPRVHVDSVSMLGNVETRSNSELLILFVYTVLVILFARGVFTKIWHHPAAAH-- 408

  Fly   621 SMLNILDCAILLGCYLALVYNIWHSFKVMSLTARAHSDVTYQSLDV------LCFWNIIYVDMMA 679
            ....::|.||    |:..|:     ..|:::.....:|...|.::.      |.|...:.:..|.
  Fly   409 EAWTMVDLAI----YILNVF-----LTVLAIMRDIETDALLQIIETATKGQYLDFQRPLRLHQML 464

  Fly   680 IL--AFLVWI---KIFKFISFNKTLVQFTTTLKRCSKDLAGFSLMFGIVFLAYAQLGLLLF---G 736
            .:  .|||.|   :::|.:.|......||.||....:.:|...::..:|.:|   :|:.|.   |
  Fly   465 FIVKGFLVCITTLRLWKVLQFASVFQHFTQTLFSAWRAVASLGVIILVVLMA---IGITLAVPNG 526

  Fly   737 TKHPDFRNFITSILTMIRMILG--------DFQYNLIEQANRVLGPIYFLTYILLVFFILLNMFL 793
            .....|.:.:.|::|.:...:|        ||.:     ..|:||.:.:|..:.|:..||:|:|.
  Fly   527 NNAVVFSHMVQSVVTCMWYSMGFNGDIHPADFFH-----GGRILGILLYLALVFLLAIILMNVFA 586

  Fly   794 AIIMETYNTVKGEITQGRSHLGSYI--------YRKLSGMLYWITHCGRK---RRHHPQASETE- 846
            ::|.:.:|.. ..|.:..|:..|..        |..|.|..:   .|.||   .|.|..|...| 
  Fly   587 SVIYDYFNET-SRILKEHSNRSSITFLEFLHVEYADLFGDAF---RCLRKTYESRGHTVAENVEL 647

  Fly   847 DKDAEHDVGAAHD---ETHEIRKNMTPAEQQYFKDIPQGENQDMVRLNNRVGLLEEILEKLI 905
            :.:....:....|   ...|:::.:...||:......:||.  :.:|...:.|..||||:::
  Fly   648 ELNRRELIKFKRDLIKSPQELKRALLTEEQRSADYRLRGEK--LFKLMAILNLQVEILERMV 707

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pkd2NP_609561.2 PKD_channel 402..803 CDD:285288 81/423 (19%)
brv2NP_648970.2 PKD_channel 169..596 CDD:285288 105/549 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121184692
eggNOG 1 0.900 E1_KOG3599
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10877
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.