DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkd2 and Pkd1l1

DIOPT Version :8

Sequence 1:NP_609561.2 Gene:Pkd2 / 34651 FlyBaseID:FBgn0041195 Length:924 Species:Drosophila melanogaster
Sequence 2:XP_017460355.1 Gene:Pkd1l1 / 289796 RGDID:1564724 Length:2771 Species:Rattus norvegicus

Alignment Length:965 Identity:174/966 (18%)
Similarity:304/966 (31%) Gaps:312/966 (32%)


  Fly    70 PPPATDPTGPPPT---AGKPVRDTGPSTS-----------------PRPSLRDPGQSTSDKPSTS 114
            ||...||.|.|.:   :..|:.|..|.|.                 |..:.||...:..::...|
  Rat  1963 PPSGPDPGGKPDSRQPSPHPISDLLPGTDQAWRMTASNSGIVHSSFPLEACRDKHLALRERSHCS 2027

  Fly   115 DKPSTSDKPSTSARTTVREPGPSSSP-----SRPVSTRESGRIT-------------FQEA---- 157
              |.:|..||:.    ..|..|..|.     |..|:...||..:             |..|    
  Rat  2028 --PPSSQAPSSG----FEELRPQQSRVCLLWSSSVAWAISGTASLACGLGTGFLGYKFVPAQCVW 2086

  Fly   158 ------------APSTSAKVVKLAASEPRPAKPPEKEGFS-------------LFKRKKKSVG-S 196
                        |..|...::.||||.....:..:.|.|:             |.:|.:..:. |
  Rat  2087 WLHLLLLSLVCCALITQPLMICLAASAFAWKRKHDSEFFTESLQDATKGLDLELEERSRTHIPLS 2151

  Fly   197 STPPSPSRGHRAPSIIAA------------------SALQNRAKTNRILYTTDEEVREALVEFSV 243
            ....||.....|..::||                  ..::.|.:..|::       :.||.:.::
  Rat  2152 PVSYSPDSAEEAERVLAARQRERHLRWAQTPSGPKFRVMRERLRRERLM-------QAALRDVTM 2209

  Fly   244 FIIFLILTSLVVLSVRHTYMFYFNDTMKKLFTNREMVVAPSVTVGFEKLITVPDWWDYLKYNFLV 308
            ..:.|:|...:.........:..|..:::.||.       :.......|.:..||||:.....|.
  Rat  2210 HSVMLLLLLFIAYGRFCPGEYSLNQAIRRAFTR-------NAHHSLGDLSSTEDWWDWTLSTLLD 2267

  Fly   309 TLHGDLTFMDDAQANLTSMPPEGSEQGSEQGSEQGSEQSPEEVVGEAPEEAPEMDRLQEDFKYNG 373
            .||.:            .||      .:..||:.|:                             
  Rat  2268 GLHPE------------RMP------ATAWGSQPGA----------------------------- 2285

  Fly   374 NPYIDLRGHRRAKRQSGVDGNSEDGSEDVSGNYLKDDSDSIQANMSFHHLEGRVFLYENLLLGPP 438
                                                             |.|:..     |:||.
  Rat  2286 -------------------------------------------------LGGQCH-----LIGPS 2296

  Fly   439 RLRQIRVRKESCYVNDAFIRYFNTCYA--AYSSGAEDRKPMHKGSPFRTMHDLD-----STPIWT 496
            .::|::|...:            .|.|  .:|...||..|||.       |.||     .||...
  Rat  2297 VIKQLKVSAGT------------ACVAPKPFSELVEDVLPMHS-------HALDLENRNVTPDDP 2342

  Fly   497 VLAFYRTGGYTVNLDYDKDRNVKIINDLKDIHWLDRGSRLCLVEFNLFNENTDIFQSIKLIAEIP 561
            .....:...||.:|...:......:..|:...|:|..:|...|.|.|:|..|.:|.|:.|.||..
  Rat  2343 KTCGVKKESYTHSLGRTRHEAHAALTALRASRWIDHSTRAVSVHFTLYNPPTRLFTSVTLGAEFL 2407

  Fly   562 PTGGVIPQAHLQTVKMYSFFTDRSM--LMTVIYIFWYIMVIYYTIYEITEIRKSGIKIYFCSMLN 624
            .|.|::..:.:::..:  |:.|.::  |:.:..:.:.::.:.:..:::.|:...||..|:.....
  Rat  2408 STRGLVSSSLIESFSI--FYRDSALQCLLMLSELLFLVLNMIHLCFQLWEMATKGILSYWRKPRQ 2470

  Fly   625 ILDCAILLGCYLALVYNIWH-SFKVMSLTARAHSDVTYQSLDV--LCFWNIIYVDMMAILAFLVW 686
            .|:.: ::|..||......| :....::|.:.|..:..:.:|:  :..||.....:..||.||..
  Rat  2471 WLELS-MVGVALAYCAASGHLTTLAENITDQFHKGLYQRFVDISLMVSWNQRARCLQGILLFLWM 2534

  Fly   687 IKIFKFISFNKTLVQFTTTLKRCSKDLAGFSLMFGIVFLAYAQLGLLLFGTKHPDFRNFITSILT 751
            :|.....|...|:..|:..  .|       ||:|.:  |....:|.||... |...|.|:....|
  Rat  2535 LKCVHLFSSLSTMAPFSAV--TC-------SLLFRV--LMPTLVGALLLAA-HSHLRWFLLYTST 2587

  Fly   752 MIR---------MIL-------GDFQYNLIEQANRVLGPIYFLTYILLVFFILLNMFLAIIMETY 800
            :.|         ::|       .|.|:|.:|..:|.:. .|:.|..||:..:...|..|..:..:
  Rat  2588 LSRGTSAEAFPGLLLQFPGRSQKDSQHNHLESDHRAVN-CYYGTLFLLLATLGFRMLRATSLTLF 2651

  Fly   801 NTVKGEITQGRSHLGSYIYRKLSGMLYWITHCGRKRRHHPQASETEDKDAEHDVGAAHDETHEIR 865
            ...|.      .|..|.:..|...:..|.......|.....:.|||                   
  Rat  2652 QDRKS------FHRKSLVTLKDVAVSMWHRLLTFLRLETTTSGETE------------------- 2691

  Fly   866 KNMTPAEQQYFKDIPQGENQDMVRLNNRVGLLEEILEKLINNMDDI-LKRVEKDY 919
               ...:..|:             |:....||:|:|.|:....|.: |..:||.:
  Rat  2692 ---VTTDHIYY-------------LDEFSSLLDELLMKIDGLSDSLELSILEKQW 2730

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pkd2NP_609561.2 PKD_channel 402..803 CDD:285288 89/429 (21%)
Pkd1l1XP_017460355.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122481254
eggNOG 1 0.900 E1_KOG3599
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.