DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkd2 and lov-1

DIOPT Version :8

Sequence 1:NP_609561.2 Gene:Pkd2 / 34651 FlyBaseID:FBgn0041195 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_496184.3 Gene:lov-1 / 174576 WormBaseID:WBGene00003058 Length:3284 Species:Caenorhabditis elegans

Alignment Length:845 Identity:158/846 (19%)
Similarity:300/846 (35%) Gaps:242/846 (29%)


  Fly   144 VSTRESGRITFQEAAPSTSAKVVKLAASEPRPAKPPEKEGFSLFKRKKKSVGSSTPPSPSRGHRA 208
            :.||:|.:|            :.||..:..| |||.|....:.:.:.:|.:|:          ..
 Worm  2612 LKTRKSHKI------------INKLEEALLR-AKPAETFLRNPYGKIEKGLGT----------EI 2653

  Fly   209 PSIIAASALQNRAKTNRILYTTDEEVREALVEFSVFIIFLILTSLVVLSVRHTYMF------YFN 267
            ..:......:||...:..|:.|   :|:.|..|:...|.::||  .....||.|.:      ..|
 Worm  2654 ADVTKLRDTENRKMRDEQLFIT---IRDMLCFFASLYIMVMLT--YYCKDRHGYWYQLEMSTILN 2713

  Fly   268 DTMKKLFTNREMVVAPSVTVGFEKLITVPDWWDYLKYNFLVTLHGDLTFMDDAQANLTSMPPEGS 332
            ...|....|.           |..:....|:||:.:.:.             |.|.|.|.     
 Worm  2714 INQKNYGDNT-----------FMSIQHADDFWDWARESL-------------ATALLASW----- 2749

  Fly   333 EQGSEQGSEQGSEQSPEEVVGEAPEEAPEMDRLQEDFKYNGNPYIDLRGHRRAKRQSGVDGNSED 397
                                                  |:|||...:|.:.              
 Worm  2750 --------------------------------------YDGNPAYGMRAYM-------------- 2762

  Fly   398 GSEDVSGNYLKDDSDSIQANMSFHHLEGRVFLYENLLLGPPRLRQIRVRKES-CYVNDAFIRYFN 461
                         :|.:..:|                 |...:||:|.:|.: |.:...|..|.|
 Worm  2763 -------------NDKVSRSM-----------------GIGTIRQVRTKKSAECTMFKQFQGYIN 2797

  Fly   462 TCYAAYSSGAEDRK-PMHKG---------------SPFRTMHDLDSTPIWTVLAFYRTGGYTVNL 510
            .|....:|..|::. .|..|               ..::|..:|.:..:..:|..|..||||:::
 Worm  2798 DCGEELTSKNEEKTLYMQAGWTELESENGTDASDEYTYKTSEELSTETVSGLLYSYSGGGYTISM 2862

  Fly   511 DYDKDRNVKIINDLKDIHWLDRGSRLCLVEFNLFNENTDIFQSIKLIAEIPPTGGVIPQAHLQTV 575
            ...:...:.:.|.|....|:|..:|..::||:.:|...:.|..::|:.|||.:|..:|.:.:::|
 Worm  2863 SGTQAEIITLFNKLDSERWIDDHTRAVIIEFSAYNAQINYFSVVQLLVEIPKSGIYLPNSWVESV 2927

  Fly   576 KMY-SFFTDRSML--MTVIYIFWYIMV----IYYTIY----EITEIR--KSGIKIYF------CS 621
            ::. |..:|.:::  ..::|||:.:::    |.:.:|    .||.::  ::..||.:      .|
 Worm  2928 RLIKSEGSDGTVVKYYEMLYIFFSVLIFVKEIVFYLYGRYKVITTMKPTRNPFKIVYQLALGNFS 2992

  Fly   622 MLNILDCAI-LLGCYLALVYNIWHSFKVMSLTARAHSDV------TYQSLDVLCFWNIIYVDMMA 679
            ..|.:|..: .|.....|.|.|     ....|.||..|.      :|.:|.....|.|::...:|
 Worm  2993 PWNFMDLIVGALAVASVLAYTI-----RQRTTNRAMEDFNANNGNSYINLTEQRNWEIVFSYCLA 3052

  Fly   680 ILAFLVWIKIFKFISFNKTLVQFTTTLKRCSKDLAGFSLMFGIVFLAYAQ-LGLLLF---GTKHP 740
            ...|....|:.:.:.||:.:.....||    .:..|..:.|||.||.::. ...:|:   |.|..
 Worm  3053 GAVFFTSCKMIRILRFNRRIGVLAATL----DNALGAIVSFGIAFLFFSMTFNSVLYAVLGNKMG 3113

  Fly   741 DFRNFITSILTMIRMILGDFQYNLIEQANRVLGPIYFLTYILLVFF------ILLNMFLAIIMET 799
            .:|:.:.:..|.:..:||......|:       ||....:::::.:      ::|.:::.|||..
 Worm  3114 GYRSLMATFQTALAGMLGKLDVTSIQ-------PISQFAFVVIMLYMIAGSKLVLQLYVTIIMFE 3171

  Fly   800 YNTVKGEITQGRS------HLGSYIYRKLSGMLYWITHCGRKRRHHPQASETEDKDAE--HDVGA 856
            :..::.:..:..:      |: .|..::..|:|       ..:...|.:.....||..  |...|
 Worm  3172 FEEIRNDSEKQTNDYEIIDHI-KYKTKRRLGLL-------EPKDFAPVSIADTQKDFRLFHSAVA 3228

  Fly   857 AHDETHEIRKNMTPAEQQYFKDIPQGENQDMVRLN---NRVGLLEEILEKLINNMDDILKRVEKD 918
            ..:..|.....|...:.||       :||.::...   :.|..:.|...|......  |..||||
 Worm  3229 KVNLLHHRATRMLQTQGQY-------QNQTVINYTLSYDPVSAIHETGPKRFQKWR--LNDVEKD 3284

  Fly   919  918
             Worm  3285  3284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pkd2NP_609561.2 PKD_channel 402..803 CDD:285288 93/454 (20%)
lov-1NP_496184.3 GPS 2177..2226 CDD:197639
PLAT_polycystin 2288..2413 CDD:238850
PKD_channel 2723..3175 CDD:285288 106/579 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3599
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.860

Return to query results.
Submit another query.