DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkd2 and pkd2l1

DIOPT Version :8

Sequence 1:NP_609561.2 Gene:Pkd2 / 34651 FlyBaseID:FBgn0041195 Length:924 Species:Drosophila melanogaster
Sequence 2:XP_002936910.2 Gene:pkd2l1 / 100495064 XenbaseID:XB-GENE-954499 Length:832 Species:Xenopus tropicalis

Alignment Length:842 Identity:241/843 (29%)
Similarity:374/843 (44%) Gaps:193/843 (23%)


  Fly   104 GQSTSDKPSTSDKPSTSDKPSTSARTTVREPGPSSSPSRPVSTRESGRITFQEAAPSTSAKVVKL 168
            |:...|.|:....||...|...:.:|.:..|..:..                             
 Frog    24 GKRAWDNPAFDGSPSLKIKAIYNPKTVLENPYDNLE----------------------------- 59

  Fly   169 AASEPRPAKPPEKEGFSLFKRKKKSVGSSTPPSPSRGHRAPSIIAASALQNRAKTNRILYTTDEE 233
            ...:|    ||.:|.    |:.|::..|.......:|.|.   :..:.|......||.||     
 Frog    60 QLGDP----PPYQEE----KKHKRNPCSQCCMYIVKGIRG---LWGTTLTENTAENRELY----- 108

  Fly   234 VREALVEFSVFIIFLILTSLVVLSVRHTYMFYFNDTMKKLFTNREMVVAPSVTVGFEKLITVPDW 298
            ::..|.|..|:|:||:...|:...:..|..:|:.:.|.|||.:.:    ....|.|:.:..:.|:
 Frog   109 IKTTLRELLVYIVFLVDICLLTYGMTSTNTYYYTNVMSKLFLDTQ----SDSGVTFKAISNMDDF 169

  Fly   299 WDYLKYNFLVTLHGDLTFMDDAQANLTSMPPEGSEQGSEQGSEQGSEQSPEEVVGEAPEEAPEMD 363
            |.||                                                       :.|.:|
 Frog   170 WSYL-------------------------------------------------------QGPMLD 179

  Fly   364 RLQEDFKYNGNPYIDLRGHRRAKRQSGVDGNSEDGSEDVSGNYLKDDSDSIQANMSFHHLEGRVF 428
            .|.....||                            :||   |.|:::|:             .
 Frog   180 GLYWTKWYN----------------------------NVS---LTDNTNSL-------------I 200

  Fly   429 LYENLLLGPPRLRQIRVRKESCYVNDAFIRYFNTCYAAYSSGAEDRKP--MHKGS--PFRTMHDL 489
            .|||||||.||:||::|:..||.|...|......|:..||...||...  :..|:  .:.|..:|
 Frog   201 YYENLLLGVPRMRQLKVKNNSCMVYKDFKDEIVGCFDVYSKDKEDTSQFGLINGTAWTYYTEEEL 265

  Fly   490 DSTPIWTVLAFYRTGGYTVNLDYDKDRNVKIINDLKDIHWLDRGSRLCLVEFNLFNENTDIFQSI 554
            ..:..|..:..|..|||.::|:..|..:::.:..||...|||||:|...|:|:::|.|.::|..:
 Frog   266 GGSSYWGKITTYSGGGYYIDLELTKRDSLRQLQTLKSNLWLDRGTRAVFVDFSVYNANINLFCVL 330

  Fly   555 KLIAEIPPTGGVIPQAHLQTVKMYSFFTDRSMLMTVIYIFWYIMVIYYTIYEITEIRKSGIKIYF 619
            :|:.|.|.|||.||...::|||:..:.:.....:....|.:.|.:.||.:.||.|:|....: ||
 Frog   331 RLVVEFPATGGAIPSWQIRTVKLIRYVSGWDYFIIGCEIVFCIFIFYYVVEEILELRIHKFR-YF 394

  Fly   620 CSMLNILDCAILLGCYLALVYNIWHSFKVMSLTARAHSDVT-YQSLDVLCFWNIIYVDMMAILAF 683
            .|:.||||..::|...:|:.::|:.:.:|..|......:.| |...:.|.||...|.:|.|:..|
 Frog   395 TSIWNILDVIVILLSLVAIGFHIFRTMEVNRLMGTLLKNPTIYADFEFLAFWQTQYNNMNAVNLF 459

  Fly   684 LVWIKIFKFISFNKTLVQFTTTLKRCSKDLAGFSLMFGIVFLAYAQLGLLLFGTKHPDFRNFITS 748
            ..||||||:||||||:.|.::||.||:||:.||::||.|||.||||||.|||||:..:|..|:..
 Frog   460 FAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIMFFIVFFAYAQLGYLLFGTQVENFSTFVKC 524

  Fly   749 ILTMIRMILGDFQYNLIEQANRVLGPIYFLTYILLVFFILLNMFLAIIMETYNTVKGEITQGRSH 813
            |.|..|:|||||.|:.|:.||||||||||:||:..|||:|||||||||.:||:.||.|::..::.
 Frog   525 IFTQFRIILGDFDYDAIDNANRVLGPIYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELSNQKNE 589

  Fly   814 LGSYIYRKLSGML---YWITHCGRK-------------RRHHPQASETEDKDAEHDVGAAHDETH 862
            |      :.|.:|   |..|....|             :..:.:....|.|::..::|  ||: |
 Frog   590 L------QFSDILKQGYKKTLLKLKLKKERISDVQKALQNGNKELKFEEFKNSLREMG--HDD-H 645

  Fly   863 EIRKNMTPAEQQYFKDIPQGENQDMVRL--NNRVGLLEEI-----------LEKLINNMDDI 911
            ||....:..:|...:.:.:.|...|.::  ..||.|..||           ||:.: |:|||
 Frog   646 EISAAFSNFDQDGNRILDEEEQMRMKQILEERRVALNAEIENLGRSYRNKRLEEEV-NLDDI 706

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pkd2NP_609561.2 PKD_channel 402..803 CDD:285288 164/406 (40%)
pkd2l1XP_002936910.2 PKD_channel 158..579 CDD:285288 175/521 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D205541at33208
OrthoFinder 1 1.000 FOG0001403
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.