DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and Rhbdf1

DIOPT Version :10

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_036012182.1 Gene:Rhbdf1 / 13650 MGIID:104328 Length:926 Species:Mus musculus


Alignment Length:80 Identity:25/80 - (31%)
Similarity:43/80 - (53%) Gaps:4/80 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CMQKVL----IFKPEWNVEYWRLLTYMLLHSDYWHLSLNICFQCFIGICLEVEQGHWRLAVVYMV 152
            ||..|.    ...||...:::||...:.||:...|..:::|||..:...||...|..|:|::|::
Mouse   683 CMDDVCGLLPFLNPEVPDQFYRLWLSLFLHAGILHCLVSVCFQMTVLRDLEKLAGWHRIAIIYLL 747

  Fly   153 GGVAGSLANAWLQPH 167
            .|:.|:||:|...|:
Mouse   748 SGITGNLASAIFLPY 762

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..252 CDD:426384 20/62 (32%)
Rhbdf1XP_036012182.1 Rhomboid_SP 139..333 CDD:463639
Rhomboid 696..>762 CDD:451297 21/65 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.