DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6712 and IMP4

DIOPT Version :9

Sequence 1:NP_477479.1 Gene:CG6712 / 34631 FlyBaseID:FBgn0032408 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_014324.3 Gene:IMP4 / 855649 SGDID:S000005019 Length:290 Species:Saccharomyces cerevisiae


Alignment Length:292 Identity:90/292 - (30%)
Similarity:154/292 - (52%) Gaps:23/292 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 KEQRLALYKKMKKEKHKKKMQERRARRKA---GVPANPGHTIESLREKDQTEVANLNDSDNEELQ 167
            :|:|..||:|.::.:..:..|:|:..::|   |.|.......:...:||.....:|.:|:..:  
Yeast     7 RERREYLYRKAQELQDSQLQQKRQIIKQALAQGKPLPKELAEDESLQKDFRYDQSLKESEEAD-- 69

  Fly   168 KELQLDDFSSYFERSYEPKVLITFADNPVTKTRKFGLELSRIFPNALVKIRNKSSVKKICKSAER 232
             :||:||..:......:|::::|.:.:|.|:..:|..|:..:||||:...|....:..:..:.::
Yeast    70 -DLQVDDEYAATSGIMDPRIIVTTSRDPSTRLSQFAKEIKLLFPNAVRLNRGNYVMPNLVDACKK 133

  Fly   233 EEFTDVVIVNEDRRKPNGLLVIHLPNGPTAHFKLSNVKLTSDI--KRDHKEITKHRPEVILNNFT 295
            ...||:|:::|.|..|..|.:.|.|:||||.|.|.||.:..||  ..:..|:   .|.:|.:|||
Yeast   134 SGTTDLVVLHEHRGVPTSLTISHFPHGPTAQFSLHNVVMRHDIINAGNQSEV---NPHLIFDNFT 195

  Fly   296 TRLGLTVGRMLGALFHHDPEFRGRRAVTFHNQRDYIFFRHHRYEFTKEGKRVKLRELGPRFTLKL 360
            |.||..|..:|..||:..|:....|.:||.|:.|:|..|.|.|..|:||  |::.|:||||.::|
Yeast   196 TALGKRVVCILKHLFNAGPKKDSERVITFANRGDFISVRQHVYVRTREG--VEIAEVGPRFEMRL 258

  Fly   361 RSLQEGTFDSKTGDYAWIISNKRHAMESRRRF 392
            ..|:.||.::|..|..|.:          |||
Yeast   259 FELRLGTLENKDADVEWQL----------RRF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6712NP_477479.1 Brix 188..358 CDD:214879 61/171 (36%)
IMP4NP_014324.3 IMP4 85..268 CDD:225047 66/187 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2136
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.