DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6712 and BRIX1

DIOPT Version :9

Sequence 1:NP_477479.1 Gene:CG6712 / 34631 FlyBaseID:FBgn0032408 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_060791.3 Gene:BRIX1 / 55299 HGNCID:24170 Length:353 Species:Homo sapiens


Alignment Length:294 Identity:55/294 - (18%)
Similarity:110/294 - (37%) Gaps:79/294 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 MKKEKHKKK----MQERRARRK---AGVPANPGHTIESLREKDQTEVAN---LNDSDNEELQKEL 170
            |...|.|::    :|.::.:|.   |..||....|.|.:.|:::..:..   .....|:|     
Human     1 MAATKRKRRGGFAVQAKKPKRNEIDAEPPAKRHATAEEVEEEERDRIPGPVCKGKWKNKE----- 60

  Fly   171 QLDDFSSYFERSYEPKVLITFADNPVT-KTRKFGLELSRIFPN--ALVKIRNKSSVKKICKSAER 232
                           ::|| |:...:. :||....:|..:.|:  |..|:..|..:..|.:..|.
Human    61 ---------------RILI-FSSRGINFRTRHLMQDLRMLMPHSKADTKMDRKDKLFVINEVCEM 109

  Fly   233 EEFTDVVIVNEDRRKPNGLLVIHLPNGPTAHFKLSNVKLTSDIKRDHKEITKHRP---------- 287
            :.....:.....:::...:.:.:.|:||:|.|.:.|:...:::|.....:...||          
Human   110 KNCNKCIYFEAKKKQDLYMWLSNSPHGPSAKFLVQNIHTLAELKMTGNCLKGSRPLLSFDPAFDE 174

  Fly   288 --------EVILNNFTTRLGLTVGRMLGALFHHDPEFRGR------RAVTFHNQRDYIFFRHHRY 338
                    |:::..|:|                 |.:..:      ...||....:.|:||:  :
Human   175 LPHYALLKELLIQIFST-----------------PRYHPKSQPFVDHVFTFTILDNRIWFRN--F 220

  Fly   339 EFTKEGKRVKLRELGPRFTLKLRSLQEGTFDSKT 372
            :..:|.  ..|.|:||||.|.|..:.:|:|...|
Human   221 QIIEED--AALVEIGPRFVLNLIKIFQGSFGGPT 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6712NP_477479.1 Brix 188..358 CDD:214879 37/196 (19%)
BRIX1NP_060791.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 11/44 (25%)
Brix 58..307 CDD:294606 44/237 (19%)
Prp31_C 321..>346 CDD:286825
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.