DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6712 and SPAC19A8.07c

DIOPT Version :9

Sequence 1:NP_477479.1 Gene:CG6712 / 34631 FlyBaseID:FBgn0032408 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_593785.1 Gene:SPAC19A8.07c / 2542446 PomBaseID:SPAC19A8.07c Length:289 Species:Schizosaccharomyces pombe


Alignment Length:290 Identity:104/290 - (35%)
Similarity:153/290 - (52%) Gaps:25/290 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 KEQRLALYKKMKKEKHKKKMQERRARRKAGVPANPGHTIESLRE--KDQTEVANL------NDSD 162
            :|:|..:||:.::.:..|..::|||.|||         :|..:|  ||..|.:.|      ::|.
pombe     7 RERRQFIYKRNQELQEAKLNEKRRALRKA---------LEGNKELNKDLQEDSQLQKDYKYDESR 62

  Fly   163 NEELQKELQLDD-FSSYFERSYEPKVLITFADNPVTKTRKFGLELSRIFPNALVKIRNKSSVKKI 226
            ..:.:.|..||| :....||  |||||:|.:..|.::..:|..|:..:.||:....|....|..:
pombe    63 ATQEETETNLDDEYHRLGER--EPKVLVTTSREPSSRLAQFAKEVRLLIPNSYRLNRGNIVVGSL 125

  Fly   227 CKSAEREEFTDVVIVNEDRRKPNGLLVIHLPNGPTAHFKLSNVKLTSDIKRDHKEITKHRPEVIL 291
            .::|...:.||:||::|.|..|:||::.|||.|||..|.|.||.|..||. :...:::..|.:|.
pombe   126 VEAARANDITDIVILHEHRGIPDGLVISHLPYGPTLSFSLHNVVLRHDIP-NTGTMSEAYPHLIF 189

  Fly   292 NNFTTRLGLTVGRMLGALFHHDPEFRGRRAVTFHNQRDYIFFRHHRYEFTKEG-KRVKLRELGPR 355
            .|.|::||..|...|.|||..||:....|.|||.|..|||.||||.|  .|.| |::.|.|.|||
pombe   190 ENLTSKLGKRVKTALSALFPPDPKDTTPRVVTFANTDDYISFRHHIY--AKTGPKQIILSEAGPR 252

  Fly   356 FTLKLRSLQEGTFDSKTGDYAWIIS-NKRH 384
            |.:||..:..||.|....|..|.:. .:||
pombe   253 FEMKLFEITLGTVDMVDADVEWKLKPYQRH 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6712NP_477479.1 Brix 188..358 CDD:214879 67/170 (39%)
SPAC19A8.07cNP_593785.1 RILP-like <7..87 CDD:304877 27/90 (30%)
IMP4 83..267 CDD:225047 75/186 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2136
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.