DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6712 and AgaP_AGAP005365

DIOPT Version :9

Sequence 1:NP_477479.1 Gene:CG6712 / 34631 FlyBaseID:FBgn0032408 Length:394 Species:Drosophila melanogaster
Sequence 2:XP_315375.4 Gene:AgaP_AGAP005365 / 1276069 VectorBaseID:AGAP005365 Length:416 Species:Anopheles gambiae


Alignment Length:381 Identity:76/381 - (19%)
Similarity:135/381 - (35%) Gaps:131/381 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DSSDEEAASSS--KKTAKQGEASEDLKEEDDDDDEEENDDDDEEEDDDDDDDKKTRI---PVLNP 99
            |.:|.:....:  ||..|.|:     |::.....:.:.|.|:.|::......|:|||   |:...
Mosquito     7 DKNDAKGKQKANLKKKFKPGK-----KQKGKQKAKPDKDSDESEDERGTVPLKETRISDEPIPKK 66

  Fly   100 LSWMRNKEQRLALYKKMKKEKHKKKMQERRARRKAGVPANPGHTIESLREKDQTEVANLNDSDNE 164
            ..| .||::.|.|..:....:.:..|::.|.       ..|.|..|...|:.:|           
Mosquito    67 SKW-TNKQRVLVLCARGINHRDRHLMRDLRT-------LMPHHRAEPKMERWKT----------- 112

  Fly   165 ELQKELQLDDFSSYFERSYEPKVLITFADNPVTKTRKFGLELSRIFPNALVKIRNKSSVKKICKS 229
                                                              :.:.|:.|..|.|..
Mosquito   113 --------------------------------------------------LSVVNEMSEMKHCNK 127

  Fly   230 AEREEFTDVVIVNEDRRKPNGLLVIHLPN---GPTAHFKLSNV------KLTSDIKRDHK----- 280
                     |::.|.|||.:  |.:.|.|   ||:..|.:.|:      |||.:..|..:     
Mosquito   128 ---------VVLFEGRRKRD--LYMWLANAGVGPSVKFLVENIHTMGEMKLTGNCLRGSRPLLSF 181

  Fly   281 --EITKHRPEVILNNFTTRLGLTVGRMLGALF---HHDPEFRG--RRAVTFHNQRDYIFFRHHRY 338
              :.|| :|.::|          :..:|..:|   :|.|:.:.  .|.:||....:.|::||.:.
Mosquito   182 SEDFTK-QPHLVL----------IKELLVQIFGVPNHHPKSQPFIDRVITFTYLDNRIWYRHFQI 235

  Fly   339 EFTKEGKRVKLRELGPRFTLKLRSLQEGTFDSKTGDYAWIISNKRHAMESRRRFFL 394
             .:::|   .|.|:||||.:....:..|:|.   ||..|  .|..:...::.|..|
Mosquito   236 -LSEDG---GLTEIGPRFVMNPIKIFSGSFG---GDPIW--ENADYQSPAKHRQML 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6712NP_477479.1 Brix 188..358 CDD:214879 41/190 (22%)
AgaP_AGAP005365XP_315375.4 Brix 67..319 CDD:294606 61/316 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.