DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr81 and WDR83

DIOPT Version :9

Sequence 1:NP_609535.1 Gene:Wdr81 / 34616 FlyBaseID:FBgn0032395 Length:1953 Species:Drosophila melanogaster
Sequence 2:NP_001093207.1 Gene:WDR83 / 84292 HGNCID:32672 Length:315 Species:Homo sapiens


Alignment Length:297 Identity:69/297 - (23%)
Similarity:122/297 - (41%) Gaps:49/297 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1621 HLKGNWLAYWRNETTRNEKDTQTLN-LKQIRLQSFVGHTNSV-RAIYALDNENSFISASKDKTVK 1683
            ::.||:..     |..::|..:..| |:...|:::.||...| .|..:.|| :|..|...||.|.
Human    34 NVDGNYCL-----TCGSDKTLKLWNPLRGTLLRTYSGHGYEVLDAAGSFDN-SSLCSGGGDKAVV 92

  Fly  1684 LWSLRSEGDGRKTSACQFTYTAHKKSINSLGFLESLRYVV--SCDSGIHLWDPFIGR--PLSVLD 1744
            ||.:.|....||       :..|...:|::.|.|....::  |.||.|..||....|  |:..||
Human    93 LWDVASGQVVRK-------FRGHAGKVNTVQFNEEATVILSGSIDSSIRCWDCRSRRPEPVQTLD 150

  Fly  1745 APRHSAVTVVKCLPSHSPLVIAGTAESTVKMVDARSCEYVNEWRVCNASLPNATVRCLAVAPSGN 1809
            ..| ..|:.|| :..|.  ::||:.:..|:..|.|..:..:::       ..:.:.|...:..|.
Human   151 EAR-DGVSSVK-VSDHE--ILAGSVDGRVRRYDLRMGQLFSDY-------VGSPITCTCFSRDGQ 204

  Fly  1810 WLAAGLSSGCIVQLDTRTGMVINSWR-------PMECDLLQLAAPSDQFLVSSALDHSLAVWHAL 1867
            ..........:..||..||.::..::       .::|.|    :..|..:||.:.|..:..|..:
Human   205 CTLVSSLDSTLRLLDKDTGELLGEYKGHKNQEYKLDCCL----SERDTHVVSCSEDGKVFFWDLV 265

  Fly  1868 DGIMHYQLKPPPEPAHFLQSVG-----PSLVYATTGN 1899
            :|.:...|   |..:..:||:.     |.|:.|..|:
Human   266 EGALALAL---PVGSGVVQSLAYHPTEPCLLTAMGGS 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr81NP_609535.1 Beach 345..588 CDD:100117
WD40 <1644..1877 CDD:225201 58/245 (24%)
WD40 1651..1876 CDD:295369 55/236 (23%)
WD40 repeat 1662..1705 CDD:293791 13/42 (31%)
WD40 repeat 1710..1744 CDD:293791 11/37 (30%)
WD40 repeat 1752..1788 CDD:293791 8/35 (23%)
WD40 repeat 1799..1836 CDD:293791 6/43 (14%)
WDR83NP_001093207.1 WD40 18..295 CDD:238121 67/291 (23%)
WD 1 23..62 7/32 (22%)
WD40 repeat 30..65 CDD:293791 7/35 (20%)
WD 2 65..104 14/39 (36%)
WD40 repeat 71..107 CDD:293791 13/43 (30%)
WD 3 107..146 11/38 (29%)
WD40 repeat 112..150 CDD:293791 11/37 (30%)
WD 4 151..188 10/40 (25%)
WD40 repeat 157..187 CDD:293791 8/32 (25%)
WD 5 190..228 6/37 (16%)
WD40 repeat 194..230 CDD:293791 6/35 (17%)
WD 6 231..272 8/44 (18%)
WD40 repeat 238..272 CDD:293791 8/37 (22%)
WD 7 275..313 6/25 (24%)
WD40 repeat 279..303 CDD:293791 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.