DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr81 and WDFY4

DIOPT Version :9

Sequence 1:NP_609535.1 Gene:Wdr81 / 34616 FlyBaseID:FBgn0032395 Length:1953 Species:Drosophila melanogaster
Sequence 2:XP_011538288.2 Gene:WDFY4 / 57705 HGNCID:29323 Length:3224 Species:Homo sapiens


Alignment Length:542 Identity:125/542 - (23%)
Similarity:191/542 - (35%) Gaps:139/542 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 DC--ITFSPALLGKNYNKTLF--------VIYQILQLAK------------HLQGQGLFLGDLRL 269
            ||  :||.|||....:::...        ::.::|...|            ||..:|:.|  ...
Human  2391 DCTQLTFFPALHESLHSEDFLELCRERQVILQELLDKEKVTQKFSLVIVQGHLVSEGVLL--FGH 2453

  Fly   270 QDIVLRENLWLQVLPRLQC--------------NLLDDDPAGEDMSPLTPLVSEDLGEAREAQQA 320
            |...:.||..|.....:.|              ||...|.:.:..|......: |:.|.|:|:..
Human  2454 QHFYICENFTLSPTGDVYCTRHCLSNISDPFIFNLCSKDRSTDHYSCQCHSYA-DMRELRQARFL 2517

  Fly   321 LP---------------------SSSTMFDLRFAYDPA---------HFNLREY-------TEMW 348
            |.                     ..|..|....::.|:         ..:||.|       .:.|
Human  2518 LQDIALEIFFHNGYSKFLVFYNNDRSKAFKSFCSFQPSLKGKATSEDTLSLRRYPGSDRIMLQKW 2582

  Fly   349 CNGQLSNFDYLTILNNACGRSLTNAAYHHIMPWVTDFSGRGGGAWRDLTKSKYRLNKGDVHLDLM 413
            ....:|||:||..||.|.||:..:...:.:.|||.          .|.|.....|....:..||.
Human  2583 QKRDISNFEYLMYLNTAAGRTCNDYMQYPVFPWVL----------ADYTSETLNLANPKIFRDLS 2637

  Fly   414 YAHASQHGSADGSY--------QAIGDQAP--HHVSDFLSEITYFVYMARRTP-QSILCA----- 462
            ....:|.......:        :..||...  |:.:.:.|.|....|:.|..| ....||     
Human  2638 KPMGAQTKERKLKFIQRFKEVEKTEGDMTVQCHYYTHYSSAIIVASYLVRMPPFTQAFCALQGGS 2702

  Fly   463 ---------HVRPIWVPAEYPVSIQRLQEWTPD-ECIPEFYS--DPMIFKSIHED--LPDLELPA 513
                     .|:..|..|... ::..::|.||: ..:|||.:  :.:.|..:.:.  |.|::||.
Human  2703 FDVADRMFHSVKSTWESASRE-NMSDVRELTPEFFYLPEFLTNCNGVEFGCMQDGTVLGDVQLPP 2766

  Fly   514 WAT-CPEDFICKHREALESQYVSERLHHWIDLNFGYKLSGKAAVKSKNV-----------CLTLV 566
            ||. .|..||..||:||||.:||..|||||||.||||..|.|||.:.|:           ..::.
Human  2767 WADGDPRKFISLHRKALESDFVSANLHHWIDLIFGYKQQGPAAVDAVNIFHPYFYGDRMDLSSIT 2831

  Fly   567 DQHRNLSQRGIV--------QLFASAHPPRRYA-TPWFSRTAPRLSQLYASPAKRLAKSTENLQA 622
            |.....:..|.|        |||...||.|..| .|...:.......|...| :....|.::|:.
Human  2832 DPLIKSTILGFVSNFGQVPKQLFTKPHPARTAAGKPLPGKDVSTPVSLPGHP-QPFFYSLQSLRP 2895

  Fly   623 ESATGSSHLSLRLGDDGSSGSV 644
            ...|........||.:...|::
Human  2896 SQVTVKDMYLFSLGSESPKGAI 2917

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr81NP_609535.1 Beach 345..588 CDD:100117 81/292 (28%)
WD40 <1644..1877 CDD:225201
WD40 1651..1876 CDD:295369
WD40 repeat 1662..1705 CDD:293791
WD40 repeat 1710..1744 CDD:293791
WD40 repeat 1752..1788 CDD:293791
WD40 repeat 1799..1836 CDD:293791
WDFY4XP_011538288.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101142at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.