DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr81 and CG7568

DIOPT Version :9

Sequence 1:NP_609535.1 Gene:Wdr81 / 34616 FlyBaseID:FBgn0032395 Length:1953 Species:Drosophila melanogaster
Sequence 2:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster


Alignment Length:367 Identity:78/367 - (21%)
Similarity:128/367 - (34%) Gaps:104/367 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1535 MKRTLSNLD----------FVLTLCHEHEQPNGQSKIQLATNVS---SGQD--VDSVDASCELAA 1584
            :|:.|..|.          |.|..||       .|.|...||||   ||:.  ..|.|.:|.: .
  Fly    89 LKQALEKLQKKLREPVKKKFYLHKCH-------NSHILPLTNVSFDRSGERCLTGSYDRTCHV-I 145

  Fly  1585 NSFGTQIVGNRLQVARNNVELIDMVAYKLDQMPKTRHLKGNWLAYWRNETTRNEKDTQTLNLKQI 1649
            |:...|:  ..:....:||  :..|.:...          :||.|                    
  Fly   146 NTQTAQV--EHILSGHDNV--VFSVGFNFP----------HWLVY-------------------- 176

  Fly  1650 RLQSFVGHTNSVRAIYALDNENSFISASKDKTVKLWSLRSEGDGRKTSACQFTYTAHKKSINSLG 1714
             |||  |.:.:....:::...:..::.|.|.|.|:||..|   |:  |.|  |:..|...:.:..
  Fly   177 -LQS--GGSGNNLTTFSIIFSDKIVTGSFDGTAKVWSATS---GQ--SLC--TFYGHTAELVAAE 231

  Fly  1715 FL----ESLRYVVSCDSGIHLWDPFIGRPLSVLDAPRHSAVTVVKCLPSHSPLVIAGTAESTVKM 1775
            |.    :|:. ..|.|....::|......|..|  ..|.|..:.........:::.|:.:.:..:
  Fly   232 FHPVDGKSIA-TASLDGSARIYDVETSHELQQL--THHGAEVIAARFNRDGQMLLTGSFDHSAAI 293

  Fly  1776 VDARSCEYVNEWRVCNASLPNATVRCLAVAPSGNWLAAGLSSGCIVQLDTRTGMVINSW--RPME 1838
            .|.||....::.|..:|.|.|.....     ||:.:|.|       .||....:    |  |.::
  Fly   294 WDVRSKSLGHQLRGHSAELSNCVWNF-----SGSLIATG-------SLDNTARI----WDTRKLD 342

  Fly  1839 CDLLQLAAPSD-----------QFLVSSALDHSLAVWHALDG 1869
            .:|...|..||           |.|.:.:.|.:..||. |:|
  Fly   343 QELYLAARHSDEVLDVSFDAAGQLLATCSSDCTARVWR-LEG 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr81NP_609535.1 Beach 345..588 CDD:100117
WD40 <1644..1877 CDD:225201 52/243 (21%)
WD40 1651..1876 CDD:295369 52/236 (22%)
WD40 repeat 1662..1705 CDD:293791 11/42 (26%)
WD40 repeat 1710..1744 CDD:293791 6/37 (16%)
WD40 repeat 1752..1788 CDD:293791 4/35 (11%)
WD40 repeat 1799..1836 CDD:293791 7/38 (18%)
CG7568NP_001263071.1 WD40 93..466 CDD:225201 77/363 (21%)
WD40 repeat 122..158 CDD:293791 11/38 (29%)
WD40 154..467 CDD:238121 58/292 (20%)
WD40 repeat 189..222 CDD:293791 11/39 (28%)
WD40 repeat 228..265 CDD:293791 7/39 (18%)
WD40 repeat 270..306 CDD:293791 4/35 (11%)
WD40 repeat 314..348 CDD:293791 10/49 (20%)
WD40 repeat 355..393 CDD:293791 7/30 (23%)
WD40 repeat 400..436 CDD:293791
WD40 repeat 442..466 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442335
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.