DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr81 and CG6015

DIOPT Version :9

Sequence 1:NP_609535.1 Gene:Wdr81 / 34616 FlyBaseID:FBgn0032395 Length:1953 Species:Drosophila melanogaster
Sequence 2:NP_651005.1 Gene:CG6015 / 42593 FlyBaseID:FBgn0038927 Length:576 Species:Drosophila melanogaster


Alignment Length:555 Identity:110/555 - (19%)
Similarity:182/555 - (32%) Gaps:188/555 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1478 NKAFGLPNDFACDLANLSLVGGASQPERAL-------------EEL-RDVFGPE----------- 1517
            :|...|....|...|...:..|||...|.|             ||: ..|.|||           
  Fly    41 DKTHSLSKSIAVCAAPTVVPLGASAVPRTLDPTLKEVTYNPRYEEMYAPVKGPEHPDLTMQQRAP 105

  Fly  1518 ------LAHTAYLTFLRFLGEANMKRTLSNLDFVLTLCHEHEQPNGQS---KIQLATNVSSGQDV 1573
                  ....|::....|   .|.:||.....:.|....: :|.:|||   .:|.|.: .:|:.|
  Fly   106 RNTLAGYVEKAHINAFEF---ENQRRTFHTYGYALDPSVD-DQADGQSFVGDLQSAYD-DNGKTV 165

  Fly  1574 DSVDASCEL---AANSFGTQIVG---------NRLQVARNNVELIDMVAYKLDQMPKTRHLKGNW 1626
            .....:.:|   ..|.....|.|         |.:.||:.|    :....:||::...||.:|  
  Fly   166 FEPPKAKKLRKQEKNDNPEDIEGFLGPWGKFENEVSVAKPN----EQERAELDELLSKRHKRG-- 224

  Fly  1627 LAYWRNETTRNEKDTQTLNLK---------------------------------QIRLQSFVGHT 1658
                |....:..::..||::|                                 :..:.::.||.
  Fly   225 ----RIPEDKPLEEKSTLHIKDAYDYQGRSYLHAPHDLGVNLRSNAPPTKCFLPKAHIHTWSGHN 285

  Fly  1659 NSVRAI-YALDNENSFISASKDKTVKLWSLRSEGDGRKTSACQFTYTAHKKSINSL-------GF 1715
            ..:.:| :.....:..:|.|.|..||||.:..|      ..|..|::.|:::|..:       .|
  Fly   286 KGISSIRWFPKTAHLLLSGSMDCRVKLWEVYGE------RRCIRTFSGHRQAIKDIAWNNRGTNF 344

  Fly  1716 LESLRYVVSCDSGIHLWDPFIGRPLSVLDAPRHSAVTVVKCLPSH-----SPLVIAGTAESTVKM 1775
            |.:     |.|..|.|||...|..:|     |.:...:..|:..|     ..|.:|||::..:..
  Fly   345 LSA-----SYDRYIKLWDAETGDVVS-----RFTTRKMPFCVKFHPDNSKQHLFVAGTSDKKIIC 399

  Fly  1776 VDARSCEYVNEW----------------------------RVCNASLP-------NATVR---CL 1802
            .|.||.:.|.|:                            |:....:|       :.|:.   .:
  Fly   400 WDTRSGDIVQEYDRHLGSVSTITFVDDNRRFVTTSDDKSMRIWEWDIPVDMKYIADPTMHSMPAV 464

  Fly  1803 AVAPSGNWLAAGLSSGCIV-----------QLDTRTGMVINSWRPMECDLLQLAAPSDQFLVSSA 1856
            .:||:|.|:|.......||           :..|.||.:::.:   .|.|  ..:|...:|||..
  Fly   465 TLAPNGKWMACQSLDNKIVIFSALNRFKMNRKKTFTGHMVSGY---ACQL--DFSPDMSYLVSGD 524

  Fly  1857 LDHSLAV-----------WHALDGIMHYQLKPPPE 1880
            .|....:           |.|.||:....|..|.|
  Fly   525 GDGKCYIWDWKTTKMYKKWQAHDGVCISALWHPHE 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr81NP_609535.1 Beach 345..588 CDD:100117
WD40 <1644..1877 CDD:225201 64/338 (19%)
WD40 1651..1876 CDD:295369 61/297 (21%)
WD40 repeat 1662..1705 CDD:293791 11/43 (26%)
WD40 repeat 1710..1744 CDD:293791 11/40 (28%)
WD40 repeat 1752..1788 CDD:293791 11/68 (16%)
WD40 repeat 1799..1836 CDD:293791 10/50 (20%)
CG6015NP_651005.1 WD40 <274..576 CDD:225201 64/307 (21%)
WD40 277..576 CDD:238121 64/304 (21%)
WD40 repeat 289..327 CDD:293791 11/43 (26%)
WD40 repeat 332..368 CDD:293791 12/45 (27%)
WD40 repeat 374..412 CDD:293791 11/37 (30%)
WD40 repeat 418..453 CDD:293791 2/34 (6%)
WD40 repeat 461..500 CDD:293791 8/38 (21%)
WD40 repeat 509..532 CDD:293791 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.