DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr81 and plrg1

DIOPT Version :9

Sequence 1:NP_609535.1 Gene:Wdr81 / 34616 FlyBaseID:FBgn0032395 Length:1953 Species:Drosophila melanogaster
Sequence 2:NP_001032331.1 Gene:plrg1 / 394977 XenbaseID:XB-GENE-964754 Length:517 Species:Xenopus tropicalis


Alignment Length:385 Identity:85/385 - (22%)
Similarity:133/385 - (34%) Gaps:112/385 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1515 GPELAHTAYLTFLRFLGEANMKRTLSNLDFVLTLCHEHEQPNGQSKIQLATNVSSGQDV------ 1573
            ||.:|.||.....|...|:..:      ...|.|      |..||:::.....:|..|:      
 Frog   104 GPGVALTADTQIQRMPSESAAQ------SLALAL------PPSQSRLEAQRTAASVGDIYRHAGH 156

  Fly  1574 --DSVDASCELAA-NSFGTQIVGNRLQVARNNVELIDMVAYKLDQMPKTR-------------HL 1622
              .|......:|: .|.||          :|:.    :||.|...|||.:             ||
 Frog   157 PERSQPPGLSMASMESGGT----------KNSA----LVAKKAPTMPKPQWHPPWKLYRVISGHL 207

  Fly  1623 ---------KGN-WLAYWRNETTRNEKDTQTLNLKQIRLQSFVGHTNSVRAIYALDNENSFISAS 1677
                     .|| |......:.|....|..:..||    .|..||.::||.:..........|..
 Frog   208 GWVRCLAVEPGNQWFVTGSADRTIKIWDLASGKLK----LSLTGHISTVRGVIVSGRSPYLFSCG 268

  Fly  1678 KDKTVKLWSLRSEGDGRKTSACQFTYTAHKKSINSLGFLESLRYVVSC--DSGIHLWDPFIGRPL 1740
            :||.||.|.|......|.       |..|..::..|....::..:|:|  ||...:||  :....
 Frog   269 EDKQVKCWDLEYNKVIRH-------YHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWD--VRTKA 324

  Fly  1741 SVLDAPRH-SAVTVVKCLPSHSPLVIAGTAESTVKMVD--------------------------- 1777
            .|.....| :||..|:| .:..|.:|.|:.::|:::.|                           
 Frog   325 GVHTLVGHTNAVATVRC-QAAEPQIITGSHDTTIRLWDMVGGKTRVTLTNHKKSVRAVVLHPRQY 388

  Fly  1778 ---ARSCEYVNEWR------VCNASLPNATVRCLAVAPSGNWLAAGLSSGCIVQLDTRTG 1828
               :.|.:.:.:|:      :.|.|..||.:..|||...| .|.:|..:|.:...|.|||
 Frog   389 TFASGSPDNIKQWKFPDGNFIQNLSGHNAIINTLAVNSDG-VLVSGADNGTMHLWDWRTG 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr81NP_609535.1 Beach 345..588 CDD:100117
WD40 <1644..1877 CDD:225201 52/224 (23%)
WD40 1651..1876 CDD:295369 50/217 (23%)
WD40 repeat 1662..1705 CDD:293791 10/42 (24%)
WD40 repeat 1710..1744 CDD:293791 8/35 (23%)
WD40 repeat 1752..1788 CDD:293791 8/65 (12%)
WD40 repeat 1799..1836 CDD:293791 11/30 (37%)
plrg1NP_001032331.1 WD40 <196..492 CDD:225201 59/267 (22%)
WD40 199..493 CDD:238121 59/264 (22%)
WD40 repeat 212..247 CDD:293791 8/38 (21%)
WD40 repeat 253..289 CDD:293791 10/42 (24%)
WD40 repeat 294..330 CDD:293791 8/37 (22%)
WD40 repeat 337..372 CDD:293791 7/35 (20%)
WD40 repeat 378..413 CDD:293791 3/34 (9%)
WD40 repeat 419..458 CDD:293791 11/30 (37%)
WD40 repeat 465..492 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.