| Sequence 1: | NP_609535.1 | Gene: | Wdr81 / 34616 | FlyBaseID: | FBgn0032395 | Length: | 1953 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_989349.1 | Gene: | daw1 / 394975 | XenbaseID: | XB-GENE-5802528 | Length: | 415 | Species: | Xenopus tropicalis |
| Alignment Length: | 225 | Identity: | 50/225 - (22%) |
|---|---|---|---|
| Similarity: | 79/225 - (35%) | Gaps: | 64/225 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1651 LQSFVGHTNSVRAIYALDNENSF----ISASKDKTVKLWSLRSEGDGRKTSACQFTYTAHKKSIN 1711
Fly 1712 SLGF--LESLRYVVSCDSGIHLWDPFIGRPLSVLDAPRHSAVTVVKCLPSHSPLVIAGTAESTVK 1774
Fly 1775 MVDARSCEYVNEWRVCNASLPNATVRCLAVAPSGNWLAAGLSSGCIVQLDTRTGMVINSWRPMEC 1839
Fly 1840 DLLQLAAPSDQFLVSSALDHSLAVWHALDG 1869 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Wdr81 | NP_609535.1 | Beach | 345..588 | CDD:100117 | |
| WD40 | <1644..1877 | CDD:225201 | 50/225 (22%) | ||
| WD40 | 1651..1876 | CDD:295369 | 50/225 (22%) | ||
| WD40 repeat | 1662..1705 | CDD:293791 | 14/46 (30%) | ||
| WD40 repeat | 1710..1744 | CDD:293791 | 10/35 (29%) | ||
| WD40 repeat | 1752..1788 | CDD:293791 | 4/35 (11%) | ||
| WD40 repeat | 1799..1836 | CDD:293791 | 6/36 (17%) | ||
| daw1 | NP_989349.1 | CEP19 | 4..>81 | CDD:317357 | |
| WD40 | 84..373 | CDD:238121 | 50/225 (22%) | ||
| WD 1 | 90..129 | 1/1 (100%) | |||
| WD40 repeat | 96..132 | CDD:293791 | 1/4 (25%) | ||
| WD 2 | 132..174 | 17/51 (33%) | |||
| WD40 repeat | 137..175 | CDD:293791 | 14/44 (32%) | ||
| WD 3 | 175..214 | 11/38 (29%) | |||
| WD40 repeat | 181..217 | CDD:293791 | 10/35 (29%) | ||
| WD 4 | 217..256 | 11/76 (14%) | |||
| WD40 repeat | 222..258 | CDD:293791 | 9/71 (13%) | ||
| WD 5 | 259..298 | 8/45 (18%) | |||
| WD40 repeat | 265..300 | CDD:293791 | 7/39 (18%) | ||
| WD 6 | 301..340 | ||||
| WD40 repeat | 306..342 | CDD:293791 | |||
| WD 7 | 343..384 | ||||
| WD40 repeat | 348..384 | CDD:293791 | |||
| WD40 | 376..414 | CDD:197651 | |||
| WD 8 | 386..415 | ||||
| WD40 repeat | 390..414 | CDD:293791 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||