DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr81 and Lis-1

DIOPT Version :9

Sequence 1:NP_609535.1 Gene:Wdr81 / 34616 FlyBaseID:FBgn0032395 Length:1953 Species:Drosophila melanogaster
Sequence 2:NP_001246361.1 Gene:Lis-1 / 36791 FlyBaseID:FBgn0015754 Length:411 Species:Drosophila melanogaster


Alignment Length:403 Identity:85/403 - (21%)
Similarity:149/403 - (36%) Gaps:110/403 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1535 MKRTLSNLDFVLTLCHEHEQPNGQSKIQLATNVSSGQDVDSV-------DASCELAANSFG---- 1588
            ||..||.        .:.|:.|.    .:|..:.|....||:       |.|.|: ...||    
  Fly     1 MKMVLSQ--------RQREELNQ----AIADYLGSNGYADSLETFRKEADLSTEV-EKKFGGLLE 52

  Fly  1589 ---TQIVGNRLQVARNNVELIDMVAYKLDQMP-KTRHLKGNW---------LAYWRNETTR---- 1636
               |.::..:.:|.....:|.:.....::..| |.:...|.|         |...|...||    
  Fly    53 KKWTSVIRLQKKVMELEAKLTEAEKEVIEGAPTKNKRTPGEWIPRPPEKFSLTGHRASITRVIFH 117

  Fly  1637 -------NEKDTQTLNLKQIRL----QSFVGHTNSVRAIYALDNENSFI-SASKDKTVKLWSLRS 1689
                   :..:..|:.:.....    :|..|||:||:.: |.|.:...: |.|.|.::|||    
  Fly   118 PIFALMVSASEDATIRIWDFETGEYERSLKGHTDSVQDV-AFDAQGKLLASCSADLSIKLW---- 177

  Fly  1690 EGDGRKTSACQFTYTAHKKSINSLGFLESLRYVVSC--DSGIHLWDPFIGRPLSVLDAPRHSAVT 1752
              |.:::..|..|...|..:::|:.|:.:..||:|.  |..|.:|:...|..:......|.    
  Fly   178 --DFQQSYECIKTMHGHDHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGHRE---- 236

  Fly  1753 VVKCLPSHSPLVIAGTA--ESTVKMVDARSCEYVNEWRVCNASLPN--ATVRCLAVAP------- 1806
            .|:.:..|....|..|.  :.|:::       ::...:.|...|.:  .||.|:|.||       
  Fly   237 WVRMVRVHIEGSIFATCSNDQTIRV-------WLTNSKDCKVELRDHEHTVECIAWAPEAAASAI 294

  Fly  1807 -------------SGNWLAAGLSSGCIVQLDTRTGMVI------NSWRPMECDLLQLA-APSDQF 1851
                         .|.:||:|.....|...|...|:.:      ::|      :..|| .|..::
  Fly   295 NEAAGADNKKGHHQGPFLASGSRDKTIRIWDVSVGLCLLTLSGHDNW------VRGLAFHPGGKY 353

  Fly  1852 LVSSALDHSLAVW 1864
            |||::.|.::.||
  Fly   354 LVSASDDKTIRVW 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr81NP_609535.1 Beach 345..588 CDD:100117
WD40 <1644..1877 CDD:225201 58/259 (22%)
WD40 1651..1876 CDD:295369 58/252 (23%)
WD40 repeat 1662..1705 CDD:293791 11/43 (26%)
WD40 repeat 1710..1744 CDD:293791 9/35 (26%)
WD40 repeat 1752..1788 CDD:293791 5/37 (14%)
WD40 repeat 1799..1836 CDD:293791 13/62 (21%)
Lis-1NP_001246361.1 LisH 9..40 CDD:128913 7/34 (21%)
WD40 100..409 CDD:238121 63/291 (22%)
WD40 repeat 111..148 CDD:293791 4/36 (11%)
WD40 repeat 154..191 CDD:293791 11/43 (26%)
WD40 repeat 196..232 CDD:293791 9/35 (26%)
WD40 repeat 239..274 CDD:293791 5/41 (12%)
WD40 repeat 280..336 CDD:293791 12/55 (22%)
WD40 repeat 342..378 CDD:293791 9/25 (36%)
WD40 repeat 384..408 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442361
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.