DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr81 and AgaP_AGAP012452

DIOPT Version :9

Sequence 1:NP_609535.1 Gene:Wdr81 / 34616 FlyBaseID:FBgn0032395 Length:1953 Species:Drosophila melanogaster
Sequence 2:XP_558717.5 Gene:AgaP_AGAP012452 / 3292356 VectorBaseID:AGAP012452 Length:668 Species:Anopheles gambiae


Alignment Length:135 Identity:37/135 - (27%)
Similarity:53/135 - (39%) Gaps:26/135 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   704 SSDLMFEQNSAEHSFTNQLFASGDELPPKSKNLLREKRN----------------CLQHLLNVRK 752
            |||| .:|.....|||....|....|....|:|:|.:||                |.:.|:|  :
Mosquito    27 SSDL-GDQTICWRSFTRSAIALQVFLADVIKSLVRTERNQQIMCENGLNEYIVCYCKELLIN--E 88

  Fly   753 ERDLHVLGCLIIELFAMQRLRPLLMGNGLTATFDSRLSACRT--VAQLHRQELPKPVRRVVRLLL 815
            :..||.....|.|..|:|:|....:.|.|..    .|..|..  ..|..:..||.|:.| |:.|:
Mosquito    89 QHPLHASLHYIFERLAVQKLMTKELRNFLRL----GLKCCNENYTDQFEKNILPVPLTR-VKTLV 148

  Fly   816 QLEQP 820
            .:..|
Mosquito   149 SITTP 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr81NP_609535.1 Beach 345..588 CDD:100117
WD40 <1644..1877 CDD:225201
WD40 1651..1876 CDD:295369
WD40 repeat 1662..1705 CDD:293791
WD40 repeat 1710..1744 CDD:293791
WD40 repeat 1752..1788 CDD:293791
WD40 repeat 1799..1836 CDD:293791
AgaP_AGAP012452XP_558717.5 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1786
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101142at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.