DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr81 and AgaP_AGAP002019

DIOPT Version :9

Sequence 1:NP_609535.1 Gene:Wdr81 / 34616 FlyBaseID:FBgn0032395 Length:1953 Species:Drosophila melanogaster
Sequence 2:XP_321036.4 Gene:AgaP_AGAP002019 / 1281099 VectorBaseID:AGAP002019 Length:347 Species:Anopheles gambiae


Alignment Length:250 Identity:60/250 - (24%)
Similarity:102/250 - (40%) Gaps:51/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1640 DTQTLNLKQIR----LQSFVGHTNSVRAIYALDNENSFISASKDKTVKLWSLRSEGDGRKTSACQ 1700
            |.:||.:.::.    |::..||||.|.........|..:|.|.|::|::|.:|       |..|.
Mosquito   120 DDKTLKIWELSSGKCLKTLKGHTNYVFCCNFNPQSNLIVSGSFDESVRIWDVR-------TGKCL 177

  Fly  1701 FTYTAHKKSINSLGFLESLRYVVSC--DSGIHLWDPFIGRPLSVLDAPRHSAVTVVKCLPSHSPL 1763
            .|..||...::::.|......:||.  |....:||...|:.|..|....:..|:.||..| :...
Mosquito   178 KTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSP-NGKY 241

  Fly  1764 VIAGTAESTVKMVDARSCEYVNEW------RVCNASLPNATVRCLAVAPSGNWLAAG-------- 1814
            ::|.|.::|:|:.|....:.:..:      :.|  ...|.:|      ..|.|:.:|        
Mosquito   242 ILAATLDNTLKLWDYSKGKCLKTYTGHRNEKYC--IFANFSV------TGGKWIVSGSEDHMVYI 298

  Fly  1815 --LSSGCIVQ-LDTRTGMVINSWRPMECDLLQLAAPSDQFLVSSAL--DHSLAVW 1864
              |.|..||| |...|..|          |.....|::..:.|:||  |.::.:|
Mosquito   299 WNLQSKEIVQTLQGHTDTV----------LCTACHPTENIIASAALENDKTIKLW 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr81NP_609535.1 Beach 345..588 CDD:100117
WD40 <1644..1877 CDD:225201 57/245 (23%)
WD40 1651..1876 CDD:295369 56/234 (24%)
WD40 repeat 1662..1705 CDD:293791 10/42 (24%)
WD40 repeat 1710..1744 CDD:293791 8/35 (23%)
WD40 repeat 1752..1788 CDD:293791 8/41 (20%)
WD40 repeat 1799..1836 CDD:293791 12/47 (26%)
AgaP_AGAP002019XP_321036.4 WD40 <47..347 CDD:225201 59/249 (24%)
WD40 50..344 CDD:238121 59/249 (24%)
WD40 repeat 61..98 CDD:293791
WD40 repeat 104..140 CDD:293791 4/19 (21%)
WD40 repeat 145..181 CDD:293791 11/42 (26%)
WD40 repeat 188..223 CDD:293791 8/34 (24%)
WD40 repeat 230..266 CDD:293791 9/36 (25%)
WD40 repeat 274..311 CDD:293791 11/44 (25%)
WD40 repeat 317..343 CDD:293791 7/35 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.