DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr81 and wdr86

DIOPT Version :9

Sequence 1:NP_609535.1 Gene:Wdr81 / 34616 FlyBaseID:FBgn0032395 Length:1953 Species:Drosophila melanogaster
Sequence 2:XP_002932539.2 Gene:wdr86 / 100486668 XenbaseID:XB-GENE-981853 Length:415 Species:Xenopus tropicalis


Alignment Length:405 Identity:98/405 - (24%)
Similarity:144/405 - (35%) Gaps:132/405 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1518 LAHTAYLTFLRFLGEANMKRTLSNLDFVLTLCH-EHEQPNGQSKIQLAT--NVSSGQDVDSVDAS 1579
            |.|::|:||                      || |:|.....|..|...  .||||:        
 Frog    76 LGHSSYITF----------------------CHLENEAAFTCSADQTVRKWEVSSGE-------- 110

  Fly  1580 CELAANSFGTQIVGNRLQVARNNVELIDMVAYKLDQMPKTRHLKGNWLAYWRNETTRNEKDTQTL 1644
            |.:..... |.|| ||:.||:..:                  ..|   :|.|...:.|....|: 
 Frog   111 CVMVYTGH-TSIV-NRILVAKGYI------------------FSG---SYDRTARSWNADSGQS- 151

  Fly  1645 NLKQIRLQSFVGHTN---------SVRAIYALDNENS-----FISASKDKTVKLWSLRSEGDGRK 1695
                  ||.|.||.|         |...:.|||.|..     .::.|.|.|:|:|...|      
 Frog   152 ------LQEFRGHRNCVLTLAHFSSYDVLEALDVEEKEVKEFLVTGSTDCTIKIWEASS------ 204

  Fly  1696 TSACQFTYTAHKKSI------NSLGFLESLRYVVSCDSGIHLWDPFIGRPLSVLDAPRHSAVTVV 1754
             ..|..|...|..:|      .|.|.|    |..|.|..|..|:...|..|:|.   ||...:|:
 Frog   205 -GCCYQTLRGHVGAILCVVLDTSNGEL----YSGSMDCTIRRWNMVTGDQLTVF---RHHQGSVI 261

  Fly  1755 KCLPSHSPLVIAGTAESTVK--MVDARSCEYVNEWRVCNASLPNATVRCLAVAPSGNWLAAGLSS 1817
             ||.....|:.:|:.:.|||  :.|...|  |..::....|:  :|::..|     ..|..|...
 Frog   262 -CLEIVGRLLYSGSVDRTVKCWLTDTGDC--VRTYKTHKHSV--STLKYHA-----GILFTGSGD 316

  Fly  1818 GCIVQLDTRTG----------MVINSWRPMECDLLQLAAPSDQFLVSSALDHSLAVWHALDGIMH 1872
            .|....:|::|          .:||      |  :|:   .|..|.:::.|.:|.||...|  :.
 Frog   317 ACARAFNTKSGTLQRVFQGHSFIIN------C--IQI---HDNSLYTASHDGALRVWDIKD--LC 368

  Fly  1873 YQLKPPPEPAHFLQS 1887
            .|.|||.:....|:|
 Frog   369 QQNKPPSKKERSLRS 383

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Wdr81NP_609535.1 Beach 345..588 CDD:100117
WD40 <1644..1877 CDD:225201 65/264 (25%)
WD40 1651..1876 CDD:295369 65/256 (25%)
WD40 repeat 1662..1705 CDD:293791 12/47 (26%)
WD40 repeat 1710..1744 CDD:293791 12/39 (31%)
WD40 repeat 1752..1788 CDD:293791 11/37 (30%)
WD40 repeat 1799..1836 CDD:293791 8/46 (17%)
wdr86XP_002932539.2 WD40 29..320 CDD:238121 79/327 (24%)