DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment escl and EED

DIOPT Version :8

Sequence 1:NP_001285857.1 Gene:escl / 34611 FlyBaseID:FBgn0032391 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001294936.1 Gene:EED / 8726 HGNCID:3188 Length:466 Species:Homo sapiens

Alignment Length:501 Identity:245/502 (49%)
Similarity:315/502 (63%) Gaps:76/502 (15%)


  Fly     1 MTETNPSEISPPSEEPPAEDESTDHSPAEAVLSNNSSSVCNVVEPDDEHEVNSVDREDTASLFST 65
            |:|...|.....::.|.|:.:.         ||::.:|     .||    ::..:.:|..|:.|.
Human     1 MSEREVSTAPAGTDMPAAKKQK---------LSSDENS-----NPD----LSGDENDDAVSIESG 47

  Fly    66 TTT---TTRSKSPNTRKLNRLCRRIKAP--------KMVQPLYKYS----SHVREDHNHQIFGVQ 115
            |.|   .|.:.:||            ||        |......|||    :.::||||..:||||
Human    48 TNTERPDTPTNTPN------------APGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQ 100

  Fly   116 FNPFLDRGQPQVFATVGKDRVSIYECERSTGQESCEGIRLLQVYADPDTDESFYTCAWSYDSVTG 180
            ||.....|.|.||||||.:||::||| .|.|:     |||||.|.|.|.||:||||||:|||.|.
Human   101 FNWHSKEGDPLVFATVGSNRVTLYEC-HSQGE-----IRLLQSYVDADADENFYTCAWTYDSNTS 159

  Fly   181 DPVLAAAGYRGVIRIFNPVKHQCSKNYIGHGHAINELKFHPTRPQLLLSGSKDHSLRLWNIQSDV 245
            .|:||.||.||:|||.||:..||.|:|:|||:|||||||||..|.||||.||||:|||||||:|.
Human   160 HPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDT 224

  Fly   246 CVAVFGGVEGHRDEVLSVDFDLRGDRIMSSGMDHSLKLWRLDKPDIKEAIELSSGFSPNKNTGPF 310
            .||:|||||||||||||.|:||.|::|||.||||||||||::...:..||:.|..::|||...||
Human   225 LVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPF 289

  Fly   311 PTIKEHFPDFSTRDIHRNYVDCVQWFGDFVFSK-------------------------SCENSIV 350
            .:.|.||||||||||||||||||:|.||.:.||                         ||||:||
Human   290 ISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSGRAILHSHQQCMRDPVSPNLRQHLSCENAIV 354

  Fly   351 CWKPGKLSESWHEIKPQESATTVLHHFDYKMCEIWFVRFAFNAWQKILALGNQLGTTFVWELDCN 415
            ||||||:.:...:|||.||..|:|..|||..|:||::||:.:.|||:||||||:|..:||:|:..
Human   355 CWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVE 419

  Fly   416 DPNLTKCSQLVHPKSNSTIRQTSFSKDGSILVCVCDDSTVWRWDRV 461
            ||:..||:.|.|.|..:.|||||||:|.|||:.||||:::|||||:
Human   420 DPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRL 465

Known Domains:


GeneSequenceDomainRegion External IDIdentity
esclNP_001285857.1 WD40 96..459 CDD:225201 222/392 (57%)
WD40 107..352 CDD:295369 159/270 (59%)
WD40 repeat 111..158 CDD:293791 26/47 (55%)
WD40 repeat 169..209 CDD:293791 25/40 (63%)
WD40 repeat 214..251 CDD:293791 28/37 (76%)
WD40 253..>459 CDD:295369 124/231 (54%)
WD40 repeat 261..323 CDD:293791 35/62 (56%)
WD40 repeat 330..378 CDD:293791 29/73 (40%)
WD40 repeat 386..426 CDD:293791 20/40 (50%)
WD40 repeat 434..458 CDD:293791 17/24 (71%)
EEDNP_001294936.1 WD40 repeat 96..140 CDD:293791 27/50 (54%)
WD40 repeat 148..188 CDD:293791 25/40 (63%)
WD40 150..463 CDD:330360 181/313 (58%)
WD40 repeat 193..230 CDD:293791 28/37 (76%)
WD40 repeat 240..302 CDD:293791 35/62 (56%)
WD40 repeat 309..382 CDD:293791 29/73 (40%)
WD40 repeat 390..430 CDD:293791 20/40 (50%)
WD40 repeat 438..462 CDD:293791 17/24 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1034
Hieranoid 1 1.000
Homologene 1 1.000 H2814
Inparanoid 1 1.050 488 1.000 Inparanoid score I1411
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1191277at2759
OrthoFinder 1 1.000 FOG0005209
OrthoInspector 1 1.000 T609077
orthoMCL 1 0.900 OOG5_130364
Panther 1 1.100 LDO PTHR10253
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2640
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.