DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment escl and mes-6

DIOPT Version :8

Sequence 1:NP_001285857.1 Gene:escl / 34611 FlyBaseID:FBgn0032391 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001021320.1 Gene:mes-6 / 177657 WormBaseID:WBGene00003224 Length:459 Species:Caenorhabditis elegans

Alignment Length:476 Identity:123/477 (26%)
Similarity:195/477 (41%) Gaps:113/477 (24%)


  Fly    69 TTRSKSPNTRKLNRLCRRI-KAPKMVQPLYKYSSHVREDHNHQIFGVQFNPFLDRGQPQVFATVG 132
            |.:.||.|....:|..... |.|      :..::.:.||....|:|..||.:....:.|..||||
 Worm     4 TKKFKSLNLHGFDRSTEDYGKRP------FVLTAKLLEDQKKAIYGCAFNQYAGIDEEQAVATVG 62

  Fly   133 KDRVSIY-------------ECERSTGQESCEGIRLLQVYADPDTDESFYTCAWSYDS------- 177
            ...:.:|             .|...|.:.|           ..:.:||.:|..|.||:       
 Worm    63 GSFLHMYSVPIDINNIELQWSCNFPTDKSS-----------KVEREESLFTVTWCYDTYEAENDR 116

  Fly   178 -----VTGDPVLAAAGYRGVIRIFNPVKHQCSKNYIGHGHAINELKFHPTRPQLLLSGSKDHSLR 237
                 |||       |..|.|.:.:.|..:.|......|..||:::..|....|::..|.|.|:|
 Worm   117 NPFKVVTG-------GTLGHIYVIDYVSRKLSNRLRSVGWEINDIRTCPANSNLIVCASSDQSIR 174

  Fly   238 LWNIQSDVCVAVFGGVEGHRDEVLSVDFDLRGDRIMSSGMDHSLKLWRLDKPDIKEAIE------ 296
            :.:|:::.|:.|.||:|.|...:||||:...||.|:|.|.||.|..|.|....:||.:|      
 Worm   175 IHHIRNEACLIVIGGLECHAGTILSVDWSTDGDFILSCGFDHQLMEWDLSVKQVKEHLERACKAL 239

  Fly   297 ----------------LSSGFS---------PNKNTG----------PFPT--IKEHFPDFSTRD 324
                            :|.|..         |:|...          |.|:  :..:.|...:.|
 Worm   240 HQDKINVLTQSQDIPYVSKGTMRKSAVSRNIPDKEEDQLLELHRELIPRPSCLLPIYTPSSVSTD 304

  Fly   325 IHRNYVDCVQWF--GDFVFSKSC--ENSIVCWK----PGKLSESWH--EIKPQESATTVLHHFDY 379
            :|.:||||:::.  .::..||.|  |.:|..|:    .|::....|  .::| :|.||.....:.
 Worm   305 MHSDYVDCIRFLIGTNYALSKGCGNEKAIHFWRFGPPKGEVENRIHGNVLRP-KSCTTKFRTMNV 368

  Fly   380 KMCEIWFVRFAFNAWQKILALGNQLGTTFVWELDCND---PNLTKCSQLVHPKSNSTIRQTSFSK 441
            .....||::||.:..::.|..|...|:...::|..|:   |..| ||     ..:.|:||.|||.
 Worm   369 PSGSAWFIKFAVDPRRRWLVCGGAGGSVMFFDLRNNEETNPTHT-CS-----VGSRTVRQASFST 427

  Fly   442 DGSILVCVCDDSTVWRWDRVN 462
            .|..||.|.|:..|.|:|||:
 Worm   428 CGRFLVLVTDEGFVCRFDRVS 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
esclNP_001285857.1 WD40 96..459 CDD:225201 113/444 (25%)
WD40 107..352 CDD:295369 78/317 (25%)
WD40 repeat 111..158 CDD:293791 13/60 (22%)
WD40 repeat 169..209 CDD:293791 12/52 (23%)
WD40 repeat 214..251 CDD:293791 11/37 (30%)
WD40 253..>459 CDD:295369 70/262 (27%)
WD40 repeat 261..323 CDD:293791 24/105 (23%)
WD40 repeat 330..378 CDD:293791 15/58 (26%)
WD40 repeat 386..426 CDD:293791 12/43 (28%)
WD40 repeat 434..458 CDD:293791 12/24 (50%)
mes-6NP_001021320.1 WD40 <112..373 CDD:225201 66/269 (25%)
WD40 120..433 CDD:295369 87/327 (27%)
WD40 repeat 152..192 CDD:293791 13/40 (33%)
WD40 repeat 197..233 CDD:293791 16/36 (44%)
WD40 repeat 245..280 CDD:293791 4/35 (11%)
WD40 repeat 310..367 CDD:293791 15/58 (26%)
WD40 repeat 375..415 CDD:293791 12/46 (26%)
WD40 repeat 420..444 CDD:293791 12/24 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C198448521
eggNOG 1 0.900 E1_KOG1034
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I3203
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1191277at2759
OrthoFinder 1 1.000 FOG0005209
OrthoInspector 1 1.000 T374628
orthoMCL 1 0.900 OOG5_130364
Panther 1 1.100 LDO PTHR10253
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2640
TreeFam 1 0.960
1312.800

Return to query results.
Submit another query.