DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment escl and Eed

DIOPT Version :8

Sequence 1:NP_001285857.1 Gene:escl / 34611 FlyBaseID:FBgn0032391 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_068676.1 Gene:Eed / 13626 MGIID:95286 Length:441 Species:Mus musculus

Alignment Length:476 Identity:245/476 - (51%)
Similarity:315/476 - (66%) Gaps:51/476 - (10%)


  Fly     1 MTETNPSEISPPSEEPPAEDESTDHSPAEAVLSNNSSSVCNVVEPDDEHEVNSVDREDTASLFST 65
            |:|...|.....::.|.|:.:.         ||::.:|     .||    ::..:.:|..|:.|.
Mouse     1 MSEREVSTAPAGTDMPAAKKQK---------LSSDENS-----NPD----LSGDENDDAVSIESG 47

  Fly    66 TTT---TTRSKSPNTRKLNRLCRRIKAP--------KMVQPLYKYS----SHVREDHNHQIFGVQ 115
            |.|   .|.:.:||            ||        |......|||    :.::||||..:||||
Mouse    48 TNTERPDTPTNTPN------------APGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQ 100

  Fly   116 FNPFLDRGQPQVFATVGKDRVSIYECERSTGQESCEGIRLLQVYADPDTDESFYTCAWSYDSVTG 180
            ||.....|.|.||||||.:||::||| .|.|:     |||||.|.|.|.||:||||||:|||.|.
Mouse   101 FNWHSKEGDPLVFATVGSNRVTLYEC-HSQGE-----IRLLQSYVDADADENFYTCAWTYDSNTS 159

  Fly   181 DPVLAAAGYRGVIRIFNPVKHQCSKNYIGHGHAINELKFHPTRPQLLLSGSKDHSLRLWNIQSDV 245
            .|:||.||.||:|||.||:..||.|:|:|||:|||||||||..|.||||.||||:|||||||:|.
Mouse   160 HPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDT 224

  Fly   246 CVAVFGGVEGHRDEVLSVDFDLRGDRIMSSGMDHSLKLWRLDKPDIKEAIELSSGFSPNKNTGPF 310
            .||:|||||||||||||.|:||.|::|||.||||||||||::...:..||:.|..::|||...||
Mouse   225 LVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPF 289

  Fly   311 PTIKEHFPDFSTRDIHRNYVDCVQWFGDFVFSKSCENSIVCWKPGKLSESWHEIKPQESATTVLH 375
            .:.|.||||||||||||||||||:|.||.:.||||||:||||||||:.:...:|||.||..|:|.
Mouse   290 ISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILG 354

  Fly   376 HFDYKMCEIWFVRFAFNAWQKILALGNQLGTTFVWELDCNDPNLTKCSQLVHPKSNSTIRQTSFS 440
            .|||..|:||::||:.:.|||:||||||:|..:||:|:..||:..||:.|.|.|..:.|||||||
Mouse   355 RFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFS 419

  Fly   441 KDGSILVCVCDDSTVWRWDRV 461
            :|.|||:.||||:::|||||:
Mouse   420 RDSSILIAVCDDASIWRWDRL 440

Known Domains:


GeneSequenceDomainRegion External IDIdentity
esclNP_001285857.1 WD40 96..459 CDD:225201 221/366 (60%)
WD40 107..352 CDD:295369 158/244 (65%)
WD40 repeat 111..158 CDD:293791 25/46 (54%)
WD40 repeat 169..209 CDD:293791 25/39 (64%)
WD40 repeat 214..251 CDD:293791 27/36 (75%)
WD40 253..>459 CDD:295369 123/205 (60%)
WD40 repeat 261..323 CDD:293791 34/61 (56%)
WD40 repeat 330..378 CDD:293791 28/47 (60%)
WD40 repeat 386..426 CDD:293791 19/39 (49%)
WD40 repeat 434..458 CDD:293791 16/23 (70%)
EedNP_068676.1 Interaction with EZH2 81..441 222/366 (61%)
WD40 repeat 96..140 CDD:293791 27/49 (55%)
WD40 repeat 148..188 CDD:293791 25/39 (64%)
WD40 150..438 CDD:356469 180/287 (63%)
WD40 repeat 193..230 CDD:293791 27/36 (75%)
WD40 repeat 240..302 CDD:293791 34/61 (56%)
WD40 repeat 309..357 CDD:293791 28/47 (60%)
WD40 repeat 365..405 CDD:293791 19/39 (49%)
WD40 repeat 413..437 CDD:293791 16/23 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C198453402
eggNOG 1 0.900 E1_KOG1034
Hieranoid 1 1.000
Homologene 1 1.000 H2814
Inparanoid 1 1.050 488 1.000 Inparanoid score I1400
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005209
OrthoInspector 1 1.000 T615904
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10253
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2640
TreeFam 1 0.960
1211.890

Return to query results.
Submit another query.