DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment escl and lrwd1

DIOPT Version :8

Sequence 1:NP_001285857.1 Gene:escl / 34611 FlyBaseID:FBgn0032391 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001120130.1 Gene:lrwd1 / 100145159 XenbaseID:XB-GENE-959481 Length:691 Species:Xenopus tropicalis

Alignment Length:474 Identity:109/475 (23%)
Similarity:189/475 (40%) Gaps:104/475 (22%)


  Fly    20 DESTDHSPAEAV-LSNNSSSVCNVVEPDDEHEVNS-------VDREDTASLFSTTTTTTRSKSP- 75
            |:.|:.||.:.. :.:...|:  .:.|...:.:.:       :.|:...|...|.:.:|.:||| 
 Frog   209 DDCTEGSPTKRTRIQHELQSI--PLSPRKSNRLQNSPLSLTPIKRKQETSTQGTPSKSTETKSPK 271

  Fly    76 --------------NTRKLNRLCRRIKAPKMVQ-------PLYKYSSHVR----EDHNHQIFGVQ 115
                          ::.|:|...:....||::|       ||:....|.:    ||...|::...
 Frog   272 VALKSTPSKKQSNESSAKINGKQKLSLTPKIIQKALDNIEPLHFLQCHSKNNSCEDFKTQLWACA 336

  Fly   116 FNPFLDRGQPQVFATVGKDRVSIYECERSTGQESCEGIRLLQVYADPDTDESFYTCAWSYDSVTG 180
            |.|.||...|:..||.|.|.|.|.:||  ||       ::::.|  ..|.|.|:|..|:..::.|
 Frog   337 FEPILDSSSPKAVATCGGDSVCIIDCE--TG-------KVMKKY--KVTGEEFFTLVWTTLTMIG 390

  Fly   181 DP-------VLAAAGYRGVIRIFNPVKHQCSKNYIGHGHAINELKFHPTRPQLLLSGSKDHSLRL 238
            ..       ||||.|..||:||.:.....|......|..||:.:.|.|.:...|.:||.|..:.|
 Frog   391 KDEQKRKINVLAAGGKHGVVRIIHAKVSLCYGEIKAHKKAISIMCFSPKQDTFLFTGSYDKRIIL 455

  Fly   239 WNIQSDVCVAVFGGVEGHRDEVLSVD---FDLR-------GDRIMSSGMDHSLKLW--RLDKPDI 291
            |:|....|...|     ...::|::|   ..||       .|..:.:..:.....|  ||||...
 Frog   456 WDIGVPDCDYNF-----RPSQLLTLDTTSVPLRMCLVPSCPDEFLVAACEDGCFAWDIRLDKKQG 515

  Fly   292 KEAIELSSGFSPNKNTGPFPTIKEHFPDFSTRDIHRNYVDCVQWFG-DFVFSKS-CENSIVCWKP 354
            :.:.|:...         ||..||...|   .|.|  .:|.:.:.. |.:.||| .:.||..|  
 Frog   516 RRSYEVELN---------FPIYKEERKD---NDFH--VIDSLAFLNEDIIASKSVMQGSIYLW-- 564

  Fly   355 GKLSESWHE-IKPQESA------TTVLHHFDYKMCEIWFVRFAFNAWQKILALGNQLGTTFVWEL 412
                 ||.: :|.:::.      ..:|....:...|..::..:.:..:..:..|::.|..::::|
 Frog   565 -----SWEKTLKTRKTKNVKKLDAVILAQMKWSSSETPYLVLSTSPERYCVFCGDEDGKIWIYDL 624

  Fly   413 DCNDPNLTK---CSQLVHP 428
            |....:|.:   ||.:..|
 Frog   625 DSCKADLQRGKLCSVVKEP 643

Known Domains:


GeneSequenceDomainRegion External IDIdentity
esclNP_001285857.1 WD40 96..459 CDD:225201 90/369 (24%)
WD40 107..352 CDD:295369 72/266 (27%)
WD40 repeat 111..158 CDD:293791 15/47 (32%)
WD40 repeat 169..209 CDD:293791 13/47 (28%)
WD40 repeat 214..251 CDD:293791 12/37 (32%)
WD40 253..>459 CDD:295369 39/201 (19%)
WD40 repeat 261..323 CDD:293791 16/74 (22%)
WD40 repeat 330..378 CDD:293791 12/57 (21%)
WD40 repeat 386..426 CDD:293791 7/43 (16%)
WD40 repeat 434..458 CDD:293791
lrwd1NP_001120130.1 LRR_RI <10..127 CDD:238064
LRR 1 22..45
LRR_8 23..81 CDD:290566
leucine-rich repeat 23..48 CDD:275380
LRR_4 48..89 CDD:289563
LRR 2 48..69
leucine-rich repeat 49..70 CDD:275380
LRR 3 70..91
leucine-rich repeat 71..92 CDD:275380
leucine-rich repeat 93..118 CDD:275380
WD40 333..689 CDD:295369 85/349 (24%)
WD40 <399..691 CDD:225201 63/272 (23%)
WD 1 426..466 13/40 (33%)
WD40 repeat 431..468 CDD:293791 12/42 (29%)
WD 2 476..516 9/40 (23%)
WD40 repeat 478..531 CDD:293791 13/62 (21%)
WD 3 535..574 13/48 (27%)
WD40 repeat 540..577 CDD:293791 11/44 (25%)
WD 4 593..632 6/39 (15%)
WD40 repeat 598..641 CDD:293791 7/43 (16%)
WD40 repeat 646..688 CDD:293791
WD 5 659..691
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.