DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or33a and Or85b

Sequence 1:NP_523553.1 Gene:Or33a FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524279.2 Gene:Or85b FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster

Alignment Length:371 Identity:68/372 (18%)
Similarity:141/372 (38%) Gaps:71/372 (19%)


  Fly    41 SFITILFPVHLILGMYKKPQIQVFRSLHFTSECLFCSYKFFCFRWK-------LKEIKTI--EGL 96
            ||:.:...:::.........::...:|.:.........|.|..|||       :.|:|.|  .||
  Fly    45 SFVGLFESIYVYSAFMDNKFLEAVTALSYIGFVTVGMSKMFFIRWKKTAITELINELKEIYPNGL 109

  Fly    97 LQDLDSRVESEEERN--YFNQNPSRVARMLSKSY--------LVAAISAIITATVAGLFSTGRNL 151
            ::        ||..|  .:....||::.:.|..|        |...:...:......:...|:.|
  Fly   110 IR--------EERYNLPMYLGTCSRISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIRVVGKQL 166

  Fly   152 MYLGWFPYDFQATAAIYWISFSYQAIGSSLLILENLANDSYPPITFCVVSG----HVRLLIMRLS 212
            .||.:.|:.:|...:.|.:.||....|.:     :.|......:..|.|:.    |...|...:.
  Fly   167 PYLMYIPWKWQDNWSYYPLLFSQNFAGYT-----SAAGQISTDVLLCAVATQLVMHFDFLSNSME 226

  Fly   213 RIGHDVKLSSSENTRKLIEGIQDHRKLMKIIRLLRSTLHLSQLGQFLSSGINISITLINILFFAE 277
            |  |::.....:::|.|::.::.|.::::                 ||..:|....:..:|.|..
  Fly   227 R--HELSGDWKKDSRFLVDIVRYHERILR-----------------LSDAVNDIFGIPLLLNFMV 272

  Fly   278 NNFAMLYYA----------------VFFAAMLIELFPSCYYGILMTMEFDKLPYAIFSSNWLKMD 326
            ::|.:.:..                :|..:.:.:::..|:||.|:.........|.::..|.|.|
  Fly   273 SSFVICFVGFQMTVGVPPDIVVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKAD 337

  Fly   327 KRYNRSLIILMQLTLVPVNIKAGGIVGIDMSAFFATVRMAYSFYTL 372
            .||.|:|:|::..:.....:||...:.|..|.....::::|.|:.|
  Fly   338 VRYKRALVIIIARSQKVTFLKATIFLDITRSTMTDLLQISYKFFAL 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 63/345 (18%)
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 63/346 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C51287
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.