DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or33a and Or85a

Sequence 1:NP_523553.1 Gene:Or33a FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524277.1 Gene:Or85a FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster

Alignment Length:385 Identity:81/386 (21%)
Similarity:163/386 (42%) Gaps:71/386 (18%)


  Fly    16 YWLY--WRLLGVEGDYPFRRLVDFTITSFITILFPVHLILGMYKKPQIQVFRSLHFTSECLFCSY 78
            :|||  |.|:               :...:.|..|..||:     ..|:.|:  :||:..|| :|
  Fly    43 WWLYYIWTLV---------------VIVLVFIFIPYGLIM-----TGIKEFK--NFTTTDLF-TY 84

  Fly    79 ------------KFFCFRWKLKEIKTIEGLLQDLDSRVESEEERNYFNQNPSRVARMLSK----- 126
                        |.....:..:.....:.::..:|.|....||:...:    |.|.:.::     
  Fly    85 VQVPVNTNASIMKGIIVLFMRRRFSRAQKMMDAMDIRCTKMEEKVQVH----RAAALCNRVVVIY 145

  Fly   127 -----SYLVAAISA--IITATVAGLFSTGRNLMYLGWFPYDFQATAAIYWISFSYQAIGSSLLIL 184
                 .||..|::.  :|..|...|::...|       |.|.      ::::.:.:::..:.:||
  Fly   146 HCIYFGYLSMALTGALVIGKTPFCLYNPLVN-------PDDH------FYLATAIESVTMAGIIL 197

  Fly   185 ENLANDSYPPITFCVVSGHVRLLIMRLSRIGHDVKLSSSENTRKLIEGIQDHRKLMKIIRLLRST 249
            .||..|.||.|...|:..|:.||..|:..:..||:....::..:|:|.::||:.:::....||..
  Fly   198 ANLILDVYPIIYVVVLRIHMELLSERIKTLRTDVEKGDDQHYAELVECVKDHKLIVEYGNTLRPM 262

  Fly   250 LHLSQLGQFLSSGINISITLINILFFAENNFAM--LYYAVFFAAMLIELFPSCYYGILMTMEFDK 312
            :..:...|.||.|:.:.:..:::.|:   |..|  :...|:..|:|.:.||.||....::.:.:.
  Fly   263 ISATMFIQLLSVGLLLGLAAVSMQFY---NTVMERVVSGVYTIAILSQTFPFCYVCEQLSSDCES 324

  Fly   313 LPYAIFSSNWLKMDKRYNRSLIILMQLTLVPVNIKAGGIVGIDMSAFFATVRMAYSFYTL 372
            |...:|.|.|:..::||..:::..:......:...||||..|.::......:.|:|..|:
  Fly   325 LTNTLFHSKWIGAERRYRTTMLYFIHNVQQSILFTAGGIFPICLNTNIKMAKFAFSVVTI 384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 70/332 (21%)
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 67/323 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5163111
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.