DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or33a and Or43a

Sequence 1:NP_523553.1 Gene:Or33a FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_523647.2 Gene:Or43a FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster

Alignment Length:395 Identity:83/396 (21%)
Similarity:152/396 (38%) Gaps:81/396 (20%)


  Fly    12 LYKTYWLYWR------------------LLGVEGDYPFRRLVDFTITSFITILFPVHLILGMYKK 58
            ||.|....||                  ||.:.||.|...|..|..::....|....|::  .|:
  Fly    22 LYPTPGSSWRKFAFVLPVTAMNLMQFVYLLRMWGDLPAFILNMFFFSAIFNALMRTWLVI--IKR 84

  Fly    59 PQIQVFRSLHFTSECLFCSYKFFCFRWKLKEIKTIEGLLQDLDSRVESEEERNYFNQNPSRVARM 123
            .|.:.|.....|   ||.|.......|.       .|:|:    |.|.|             ||.
  Fly    85 RQFEEFLGQLAT---LFHSILDSTDEWG-------RGILR----RAERE-------------ARN 122

  Fly   124 LSKSYLVAAISAIITATVAGLFSTGRNLMYLGWFPYDFQATAAIYWISFSYQAIGSSLLILENLA 188
            |:...|.|:...|:.|.|:.||...|.      .|:...........|..|:.|..:.|....|.
  Fly   123 LAILNLSASFLDIVGALVSPLFREERA------HPFGLALPGVSMTSSPVYEVIYLAQLPTPLLL 181

  Fly   189 NDSYPPITFCVV------SGHVRLLIMRLSRIGHDVKLSSSENTRKLIEGIQDHRKLMKIIRLLR 247
            :..|.|......      ...:::|:.||.:||.: :.|..|..::|...|..|.::|:      
  Fly   182 SMMYMPFVSLFAGLAIFGKAMLQILVHRLGQIGGE-EQSEEERFQRLASCIAYHTQVMR------ 239

  Fly   248 STLHLSQLGQFLSSGINISI----TLINILFFAENNFA----MLYYAVFFAAMLIELFPSCYYGI 304
               ::.||.:.:::.:.:..    ::|..|.|..|...    ::...::...||..||  .||..
  Fly   240 ---YVWQLNKLVANIVAVEAIIFGSIICSLLFCLNIITSPTQVISIVMYILTMLYVLF--TYYNR 299

  Fly   305 L--MTMEFDKLPYAIFSSNWLKMDKRYNRSLIILMQLTLVPVNIKAGGIVGIDMSAFFATVRMAY 367
            .  :.:|.:::..|:::..|.:...|:.::|:|.:..|..|:.|:.|.:..:.::.|.:.:..:|
  Fly   300 ANEICLENNRVAEAVYNVPWYEAGTRFRKTLLIFLMQTQHPMEIRVGNVYPMTLAMFQSLLNASY 364

  Fly   368 SFYTL 372
            |::|:
  Fly   365 SYFTM 369

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 64/322 (20%)
Or43aNP_523647.2 7tm_6 56..364 CDD:251636 72/355 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49688
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.