DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or33a and Or65b

Sequence 1:NP_523553.1 Gene:Or33a FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_729162.3 Gene:Or65b FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster

Alignment Length:433 Identity:87/434 (20%)
Similarity:167/434 (38%) Gaps:90/434 (21%)


  Fly     1 MDSRRKVRSENLYKTYW---------------LYW---------------RLLGVEGDYPFRRLV 35
            ||.:|.::   .||..|               .||               |||      |:|...
  Fly     1 MDIQRFLK---FYKVGWKTYRDPLMEASHSSIYYWREQMKAMALFTTTEERLL------PYRSKW 56

  Fly    36 DFTITSFITILFPVHLILGMYKK--PQIQVFRSLHFTSECLFCSYKFFCFRWKLKEIKTIEGLLQ 98
             .|:.....::|...:..|:.:.  ..:|:.|.|.|.....|..:|.:.|.|...|   ::.::.
  Fly    57 -HTLVYIQMVIFFASMSFGLTESMGDHVQMGRDLAFILGAFFIIFKTYYFCWYGDE---LDQVIS 117

  Fly    99 DLD----------SRVESEE-ERNYFNQNPSRVARMLSKSYLVAAISAIITATVAGLFSTGRNLM 152
            |||          :.||.:. :|.||     .:|..|:.|:.......::....:.::...:||.
  Fly   118 DLDALHPWAQKGPNPVEYQTGKRWYF-----VMAFFLATSWSFFLCILLLLLITSPMWVHQQNLP 177

  Fly   153 YLGWFPYDFQATA------AIYWISFSYQAIG--SSLLILENLANDSYPPITFCVVSGHVRLLIM 209
            :...||:.:...:      ||.::..||.|:.  :.||.:|.|:...|..|||     .:.:|.:
  Fly   178 FHAAFPFQWHEKSLHPISHAIIYLFQSYFAVYCLTWLLCIEGLSICIYAEITF-----GIEVLCL 237

  Fly   210 RLSRI-GHDVKLSSSE-NTRKLIEGIQDHRKLMKIIRLLRSTLHLSQLGQFLSSGINISITLINI 272
            .|.:| .|:..|.... .|.:|   ::.|:|:::|:.......|.:.:.|.   |:|.|:..:::
  Fly   238 ELRQIHRHNYGLQELRMETNRL---VKLHQKIVEILDRTNDVFHGTLIMQM---GVNFSLVSLSV 296

  Fly   273 LFFAE---NNFAMLYYAVFFAAMLIELFPSCYYGILM---TMEFDKLPYAIFSSNWLKMDKRYNR 331
            |...|   :...:..:||.....|..|....|.|..:   :::..:..|..:...  |..|...|
  Fly   297 LEAVEARKDPKVVAQFAVLMLLALGHLSMWSYCGDQLSQKSLQISEAAYEAYDPT--KGSKDVYR 359

  Fly   332 SLIILMQLTLVPVNIKAGGIVGIDMSAFFATVRMAYSFYTLAL 374
            .|.::::....|:.::|......::..:.|.:...|...|..|
  Fly   360 DLCVIIRRGQDPLIMRASPFPSFNLINYSAILNQCYGILTFLL 402

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 68/333 (20%)
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 68/333 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C51745
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.