DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycY and SIP3

DIOPT Version :10

Sequence 1:NP_609519.1 Gene:CycY / 34593 FlyBaseID:FBgn0032378 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_014142.1 Gene:SIP3 / 855464 SGDID:S000005201 Length:1229 Species:Saccharomyces cerevisiae


Alignment Length:132 Identity:27/132 - (20%)
Similarity:59/132 - (44%) Gaps:29/132 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 ELDVGPCNWKRMVLGAILLASKVWDDQAVW---NVDYCQILKDITVEDMNELERQFLELLQFNIN 327
            ::|:.||            .::..|:.|:|   :::..::|.    .|::..::|........| 
Yeast   232 KIDLSPC------------INEYLDNYAIWVENSIEGSKVLD----SDISNAKKQAYRYTLKRI- 279

  Fly   328 VPSSVYAKYYFDLRTLAEANELNFPTE--PLSKERAQKLEAMSRVMQDKVTAEALKNGIKKWSSM 390
            .|||..:.|  ::|::..:..|:..|:  |.|.|::..|...::|  .|.|.|.   .:::|..:
Yeast   280 TPSSDTSDY--NIRSIHSSKLLSKDTQVPPKSPEKSGWLYMKTQV--GKPTREI---WVRRWCFL 337

  Fly   391 DN 392
            .|
Yeast   338 KN 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycYNP_609519.1 CYCLIN_CCNY_like 228..324 CDD:410243 9/60 (15%)
SIP3NP_014142.1 BAR_SIP3_fungi 32..253 CDD:153293 6/32 (19%)
PH_SIP3 311..427 CDD:270098 8/34 (24%)
VASt 776..946 CDD:464975
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.