DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6488 and COG8

DIOPT Version :8

Sequence 1:NP_609503.2 Gene:CG6488 / 34571 FlyBaseID:FBgn0032361 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_013640.1 Gene:COG8 / 854904 SGDID:S000004536 Length:607 Species:Saccharomyces cerevisiae

Alignment Length:610 Identity:123/611 (20%)
Similarity:213/611 (35%) Gaps:210/611 (34%)


  Fly     8 DLENERVLKLIFPDGVPDNLRGN-PELDNYLAKLG-----TCKVEQLKKEQTRLAEEAR-TILEQ 65
            ||..|:  |.:..|.:.|.|:.| .:.::|.:...     |..:.::..|.:.|..:.| |:|:.
Yeast    12 DLTEEQ--KRLSLDFLQDILQSNTKDYESYFSSRAVPGSITEDIAEIDAELSALDRKIRKTLLDN 74

  Fly    66 TQDLAISNYRTFITTAEN-SRSIFSEFLRSEQQ---LDTLVSKLPDL----------SVQCERFL 116
            |..: |.|      ..|| .|:...:..:|.:|   |||.::|..|.          ||..:.||
Yeast    75 TSQI-IGN------ILENDDRAQLDDIAKSLEQLWELDTNINKAADRNVTNDDINNESVSIDDFL 132

  Fly   117 QDSAELNEQRRLNS-----------------------------------------ITLQKNA-QL 139
            :|..|.|:..|:.:                                         :|:.:|. .:
Yeast   133 EDDKEDNDTGRIMTTESNNLARKKKEDEFHKALSRLRNRISTKEDDKDDIRSDTLVTVLENLDSI 197

  Fly   140 LEVLELPQLMERCIREGRYEEALELAAYATRLGQHQGHIPVVTSIVRSV-EALWHNMLVQLVAQL 203
            .:::|||.|...|||.|.|:||:.|..:.|.|........:|..:...| ..:...||..||..|
Yeast   198 TDLMELPFLARTCIRTGHYQEAVMLYTHTTSLRSRFPGSTIVDEVCEKVLNEISTTMLSGLVKLL 262

  Fly   204 RTDLQLPKCLQIVGYLRRMQAFG---DNELRLKFLQARDAWLTSCLEAIPTADAQQH-------- 257
            .|::.:....:|:.||..:..|.   :..|...||..|..::|..:.:.| .|.:..        
Yeast   263 STNVSVNSLKKILQYLNSIPPFDGKTNKSLLSVFLAMRYKFITDEIASYP-LDVESSNESLIEMM 326

  Fly   258 LSKTIEITRINLFNIITQYRAIFPEDEGTL------KTQSSLRPLQGVSCNGDRLF--------- 307
            :.:.||:.|.:::..:..:...|..|...|      :.:|::..:.|.  |.::..         
Yeast   327 VKRKIEVLREHVYMSLNVFLKSFLYDTNDLEIPFPEELESTVLRINGT--NEEKEIEEKEKETKK 389

  Fly   308 -----QAWLHNKISDF-----LQTLERDLQLGVGSVETVLGQCMYFGLSFSRVGADFRALMAPIF 362
                 |..:.|...|.     ::.::.::|   |.||                |.|..|      
Yeast   390 EEYQKQDSVANNEEDVTENKSIEDVQEEVQ---GKVE----------------GEDDGA------ 429

  Fly   363 VGVIRRRFESSVEQ--------------------VDEQFERELERFTLINKV---------ALHS 398
                .|:.|:.:|.                    .|.:.|:|.|.   ||||         ::.:
Yeast   430 ----ERKTENEIENETVNKTEDKAEKEKEEEVNTKDNKAEKEEEE---INKVEVTPEEPSKSIDN 487

  Fly   399 HARK--------QVDPEQ----------ESYAPPEA-LLDF------YPLAALCNGYLSALNELR 438
            .|.|        :|.||:          |:..|..| :|.|      |.|..|..|    ||.::
Yeast   488 KAEKEEEEINKVEVTPEEPSKKIRTSKRENKIPTNAVMLQFVDKCITYVLKDLTRG----LNSIK 548

  Fly   439 L----CAPLALAT----DVTRCLQH 455
            |    |..|...:    |:.|...|
Yeast   549 LSDSVCLQLVYCSFRLCDLNRNYHH 573

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6488NP_609503.2 Dor1 37..379 CDD:252394 85/461 (18%)
COG8NP_013640.1 Dor1 28..375 CDD:252394 73/357 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C192718392
eggNOG 1 0.900 E1_KOG2069
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004180
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21311
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.