DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6488 and AT5G11980

DIOPT Version :8

Sequence 1:NP_609503.2 Gene:CG6488 / 34571 FlyBaseID:FBgn0032361 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_568256.1 Gene:AT5G11980 / 831071 AraportID:AT5G11980 Length:569 Species:Arabidopsis thaliana

Alignment Length:546 Identity:173/546 - (31%)
Similarity:283/546 - (51%) Gaps:30/546 - (5%)


  Fly    36 YLAKLGTCKVEQLKKEQTRLAEEARTILEQTQDLAISNYRTFITTAENSRSIFSEFLRSEQQLDT 100
            |:::|.:..:::|.||...|..:|..|..|.|::|:.|||.|||.|:...:|..|....::.|::
plant    28 YVSELLSFTLDRLHKEPELLRVDAERIQRQMQEVAVGNYRAFITAADALLAIRQEVSSIDKHLES 92

  Fly   101 LVSKLPDLSVQCERFLQDSAELNEQRRLNSITLQKNAQLLEVLELPQLMERCIREGRYEEALELA 165
            |:.::|.|:..|..|:..:..:.|:|::|...|..::.||::||:||||:.|:|.|.::|||:|.
plant    93 LIGEVPKLTSGCTEFIDSAENILEKRKMNQALLANHSTLLDLLEIPQLMDTCVRNGNFDEALDLE 157

  Fly   166 AYATRLGQHQGHIPVVTSIVRSVEALWHNMLVQLVAQLRTDLQLPKCLQIVGYLRRMQAFGDNEL 230
            |:.::|......:||:.::...|.....::|.||:.:||:::|||:||:|:|||||:..||:.|:
plant   158 AFVSKLATLHPKLPVIQALAAEVRQTTQSLLSQLLQKLRSNIQLPECLRIIGYLRRIGVFGEYEM 222

  Fly   231 RLKFLQARDAWLTSCLEAIPTADAQQHLSKTIEITRINLFNIITQYRAIFPEDEGTLKTQSSLRP 295
            ||:||:.|:||||..||.:...:|.::|...|...|::||:::.||||||.:|     |..|.. 
plant   223 RLQFLRCREAWLTGILEDLDQKNAYEYLKGMINCHRMHLFDVVNQYRAIFSDD-----TSGSEE- 281

  Fly   296 LQGVSCNGDRLFQAWLHNKISDFLQTLERDLQ--LGVGSVETVLGQCMYFGLSFSRVGADFRALM 358
                :.:|..|| :|..::|:..|:||:..|.  ...||:..:|.||||..:....||.|||.|:
plant   282 ----NYDGGLLF-SWAMHQITSHLKTLKIMLPKITEGGSLSNILDQCMYCAMGLGGVGLDFRGLL 341

  Fly   359 APIFVGVIRRRFESSVEQVDEQFERELE--RFTLINKVALHSHARKQVDPEQESYAPPEALLDFY 421
            .|:|...:...|..::....|.|:..|:  |:..:..|...|....  :..::...||..|::..
plant   342 PPLFEEAVLNLFSKNMSTAVENFQLVLDSHRWVPLPSVGFPSSGIN--EDSKDDVTPPSYLMEHP 404

  Fly   422 PLAALCNGYLSALNELRLCAPLALATDVTRCLQHSLQQAAQRVLAFYRQEQQAFAGSEREAFVRL 486
            |||...||..|||||||.||||:|...|...|...||..:..:|.:  ...:....||...|:.|
plant   405 PLAVFINGVSSALNELRPCAPLSLKNVVAHELIKGLQAVSDSLLRY--NTTRMLRLSESNLFLSL 467

  Fly   487 CSCLAYDLVPYIQRCIHGVFP--------PQSLTVHLGISLLQLEQQQLTYLQQTRILEPLKHLL 543
            |......:.|:...|....:|        .:|....||..|.....|:.:......|....|...
plant   468 CRAFVEVVFPHCATCFGRCYPGGATIVMDAKSAYEGLGRILAASSSQEPSNKSPKVISTDTKDAS 532

  Fly   544 PTKALVQPQDKVME---AKPSAGVPV 566
            ......||::|..|   ||.....|:
plant   533 ENGVASQPEEKQAENPNAKEEDNSPI 558

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6488NP_609503.2 Dor1 37..379 CDD:252394 119/343 (35%)
AT5G11980NP_568256.1 Dor1 29..362 CDD:252394 119/343 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H13018
Inparanoid 1 1.050 272 1.000 Inparanoid score I891
OMA 1 1.010
OrthoDB 1 1.010 D1531483at2759
OrthoInspector 1 1.000 T193389
orthoMCL 1 0.900 OOG5_128891
Panther 1 1.100 LDO PTHR21311
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.