DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6488 and Cog8

DIOPT Version :8

Sequence 1:NP_609503.2 Gene:CG6488 / 34571 FlyBaseID:FBgn0032361 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001099652.1 Gene:Cog8 / 291990 RGDID:1307074 Length:634 Species:Rattus norvegicus

Alignment Length:549 Identity:248/550 (45%)
Similarity:344/550 (63%) Gaps:13/550 (2%)


  Fly     8 DLENERVLKLIFPDGVPD-NLRGNPELDNYLAKLGTCKVEQLKKEQTRLAEEARTILEQTQDLAI 71
            ::|:|.:|..:|.|..|: ..|..|::..||.:|....:::|::|..|||||...:|:||:|||.
  Rat    26 EVEDEGLLASLFRDRFPEAQWREKPDVGRYLRELSGSGLDRLRREPERLAEERAQLLQQTRDLAF 90

  Fly    72 SNYRTFITTAENSRSIFSEFLRSEQQLDTLVSKLPDLSVQCERFLQDSAELNEQRRLNSITLQKN 136
            :||:|||..||.:..|...|...|..|..|:.:||.....|..|::::.|::..||:|::||.::
  Rat    91 ANYKTFIRGAECTERIHRLFGDVEASLGHLLDRLPSFQQSCRNFVKEAEEISSNRRMNTLTLNRH 155

  Fly   137 AQLLEVLELPQLMERCIREGRYEEALELAAYATRLGQHQGHIPVVTSIVRSVEALWHNMLVQLVA 201
            .::||:||:||||:.|:|...||||||||||..||.:....|||:..||..|......||.||:.
  Rat   156 TEILEILEIPQLMDTCVRNSYYEEALELAAYVRRLERKYSSIPVIQGIVNEVRQSMQLMLSQLIQ 220

  Fly   202 QLRTDLQLPKCLQIVGYLRRMQAFGDNELRLKFLQARDAWLTSCLEAIPTADAQQHLSKTIEITR 266
            ||||.:|||.||:::||||||..|.:.|||:||||||||||.|.|.|||..|...|::||||..|
  Rat   221 QLRTSIQLPACLRVIGYLRRMDVFTEAELRVKFLQARDAWLRSILTAIPNDDPYFHITKTIEACR 285

  Fly   267 INLFNIITQYRAIFPEDEGTLKTQSSLRPLQG-VSCNGDRLFQAWLHNKISDFLQTLERDLQLGV 330
            ::||:||||||||| .||..|     |.|..| .:.|...:|..|:..|||.|||.||.||..|:
  Rat   286 VHLFDIITQYRAIF-SDEDPL-----LPPAMGQYTVNEGAIFHGWVLQKISQFLQVLETDLYRGI 344

  Fly   331 GS-VETVLGQCMYFGLSFSRVGADFRALMAPIFVGVIRRRFESSVEQVDEQFERELERFTLINKV 394
            |. ::::|||||||||||||||||||..:||:|..|....|:.:||:..|:|:.|:..:|||:..
  Rat   345 GGRLDSLLGQCMYFGLSFSRVGADFRGQLAPVFQRVAINTFQKAVEEAVEKFQDEMTSYTLISAA 409

  Fly   395 AL--HSHARKQVDPEQE-SYAPPEALLDFYPLAALCNGYLSALNELRLCAPLALATDVTRCLQHS 456
            |:  .|:....|...|. :..||..||||.|||...|..|.|.|:||||.|:|||.|||..|:.:
  Rat   410 AILGSSNMPAAVPATQPGTLQPPMVLLDFPPLACFLNNILVAFNDLRLCCPVALAQDVTGALEDA 474

  Fly   457 LQQAAQRVLAFYRQEQQAFAGSEREAFVRLCSCLAYDLVPYIQRCIHGVFPPQSLTVHLGISLLQ 521
            |.:..:.:|||:|.|:..|:..|.|.||:.|:....|||||:.||:..:|||..:...||||..|
  Rat   475 LMKVTKTILAFHRAEEAVFSSGEHEIFVQFCTAFLEDLVPYLNRCLQVLFPPAQIAQTLGISPTQ 539

  Fly   522 LEQQ-QLTYLQQTRILEPLKHLLPTKALV 549
            |.:. .|.::..:.|.|||..:||.:..|
  Rat   540 LSKHGNLGHVNISAIQEPLAFILPKREAV 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6488NP_609503.2 Dor1 37..379 CDD:252394 168/344 (49%)
Cog8NP_001099652.1 Dor1 56..394 CDD:252394 168/344 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C192712990
eggNOG 1 0.900 E1_KOG2069
Hieranoid 1 1.000
Homologene 1 1.000 H13018
Inparanoid 1 1.050 449 1.000 Inparanoid score I1539
OMA 1 1.010
OrthoDB 1 1.010 D1531483at2759
OrthoFinder 1 1.000 FOG0004180
OrthoInspector 1 1.000 T1087960
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21311
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.