DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6488 and cog8

DIOPT Version :8

Sequence 1:NP_609503.2 Gene:CG6488 / 34571 FlyBaseID:FBgn0032361 Length:570 Species:Drosophila melanogaster
Sequence 2:XP_002937620.1 Gene:cog8 / 100495068 XenbaseID:XB-GENE-955478 Length:598 Species:Xenopus tropicalis

Alignment Length:545 Identity:231/545 - (42%)
Similarity:341/545 - (62%) Gaps:8/545 - (1%)


  Fly     7 MDLENERVLKLIFPDGVPDNLRGNPELDNYLAKLGTCKVEQLKKEQTRLAEEARTILEQTQDLAI 71
            ||:|:|.:|..:|....|::.|.:|:..:||.:|.:..:::|::|..||::|...||:||:|||.
 Frog     4 MDVEDEGLLASVFRASFPESWRDSPDFASYLLELSSFGLDKLRREPERLSDERSQILQQTRDLAF 68

  Fly    72 SNYRTFITTAENSRSIFSEFLRSEQQLDTLVSKLPDLSVQCERFLQDSAELNEQRRLNSITLQKN 136
            |||:|||.|||.:..|:.:|.:.|..:..|::|||.....|..|::.:.|::..||:|::||.::
 Frog    69 SNYKTFIRTAECTELIYRDFGQVEGSVSHLLNKLPSFQESCRNFVKQAEEISSSRRMNTLTLNRH 133

  Fly   137 AQLLEVLELPQLMERCIREGRYEEALELAAYATRLGQHQGHIPVVTSIVRSVEALWHNMLVQLVA 201
            .::||:||:||||:.|:|.|.||||||||||..||.:....:||:..||..|......||.||:.
 Frog   134 TEILEILEIPQLMDTCVRNGYYEEALELAAYVRRLEKKHSSVPVIQGIVNEVRQSAQLMLNQLLQ 198

  Fly   202 QLRTDLQLPKCLQIVGYLRRMQAFGDNELRLKFLQARDAWLTSCLEAIPTADAQQHLSKTIEITR 266
            |||:::|||.||:::||||||..|.:.|||:|||||||:||.|...:||..|...||:||||..|
 Frog   199 QLRSNIQLPACLRVIGYLRRMDVFTEAELRIKFLQARDSWLRSLQNSIPNDDPYFHLTKTIESCR 263

  Fly   267 INLFNIITQYRAIFPEDEGTLKTQSSLRPLQGVSCNGDRLFQAWLHNKISDFLQTLERDLQLGVG 331
            :|||::||||||||.:::..|....   |...:..:...:|..|:..|:::|||.|:.|||.|||
 Frog   264 VNLFDVITQYRAIFSDEDPLLLPPP---PTGTLPISEGAIFHGWVLQKVTEFLQVLQNDLQRGVG 325

  Fly   332 S-VETVLGQCMYFGLSFSRVGADFRALMAPIFVGVIRRRFESSVEQVDEQFERELERFTLIN-KV 394
            . ::::|||||||||||||||.|||..:.|||..|....|..:|.:..|:|:.|:..:|||: ..
 Frog   326 GRLDSLLGQCMYFGLSFSRVGVDFRGQLPPIFQRVAAETFAKAVHEAVEKFQEEMNMYTLISAPT 390

  Fly   395 ALHSHARKQVDPEQE--SYAPPEALLDFYPLAALCNGYLSALNELRLCAPLALATDVTRCLQHSL 457
            .|.|.......|..:  :..||..||||.|||...|..|.|.|:||||.|:||...||..||.:|
 Frog   391 VLGSTITPVPTPTAQPGTLQPPMVLLDFPPLACFLNNILVAFNDLRLCCPVALTEAVTTTLQDAL 455

  Fly   458 QQAAQRVLAFYRQEQQAFAGSEREAFVRLCSCLAYDLVPYIQRCIHGVFPPQSLTVHLGISLLQL 522
            ::..:.:|.|.|.|:.||:..|||.|::.|:....||.|::.||:..:|||......||::...|
 Frog   456 EKVVKTILTFQRAEEAAFSMQERELFIQFCTVFLEDLTPFLNRCLQVLFPPAQRAQILGVAPAHL 520

  Fly   523 EQQ-QLTYLQQTRILEPLKHLLPTK 546
            .:. .|..:..|.:.|.|:.:||.|
 Frog   521 SRYGNLCSIDVTVLQEALEGILPQK 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6488NP_609503.2 Dor1 37..379 CDD:252394 158/342 (46%)
cog8XP_002937620.1 Dor1 34..374 CDD:252394 158/342 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C192705754
eggNOG 1 0.900 E1_KOG2069
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H13018
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1531483at2759
OrthoFinder 1 1.000 FOG0004180
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.