DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi21 and Osi11

DIOPT Version :8

Sequence 1:NP_609501.1 Gene:Osi21 / 34566 FlyBaseID:FBgn0283678 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_649630.1 Gene:Osi11 / 40765 FlyBaseID:FBgn0037418 Length:302 Species:Drosophila melanogaster

Alignment Length:278 Identity:77/279 (28%)
Similarity:122/279 (44%) Gaps:65/279 (23%)


  Fly     3 RLEWLLLLALVASVSTAV-TPRRRRHSAVESATTSSPGDWGTAWGLGPEMALVRRVYDDCQDKND 66
            ||..|:.|.|.|..:.|: .|.....::.||             ||   :..||.:|..|....|
  Fly     4 RLGLLIALLLAAFQAWAMEAPSNYNQNSTES-------------GL---LRTVRHIYGQCAYSED 52

  Fly    67 FIGCLKQKALHALSRALDQDSIKIVDGLALEKQ------NQSETESILGSLTDARQFGNLS--PI 123
            ...|.|.:.:..|.|||....:.||||::|.::      .:|...|:|.|....|...:||  .:
  Fly    53 VFWCCKIQGVRLLGRALKVPQLGIVDGVSLVRRESFTQDTRSGRSSLLESQLSNRDLEHLSGKSL 117

  Fly   124 DRALLSKADKLMRTHTLKIDMD--VGGGEDSV--------------GREHGHKKKKHKEGGHIKY 172
            |..||.:....:.:|.|::::.  :..||.:|              ....|.|||..|     ||
  Fly   118 DALLLERFLNFVHSHQLQVNLPRLLRFGERNVQDWLLHVVGYFMPASESEGRKKKDDK-----KY 177

  Fly   173 V---VAALLTAMGIAGPLGLKALAAIAGKALVISKVALTIAGIIALKKLFSHDHSEETSFQV--- 231
            :   :||:|....|. .:...::|.:|||||::.|:||.|:.||.||||..||..|:|::::   
  Fly   178 LGPFIAAVLLKTAIL-KMAYHSIAIVAGKALIVGKIALIISAIIGLKKLVGHDGGEKTTYEIVKH 241

  Fly   232 ------------HAGEHN 237
                        |.||::
  Fly   242 PQVQQSHTYSSSHQGEYD 259

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi21NP_609501.1 DUF1676 79..>152 CDD:285181 23/83 (28%)
Osi11NP_649630.1 DUF1676 65..180 CDD:285181 31/120 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2AK5C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.