DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ab and BtbVII

Sequence 1:NP_476562.1 Gene:ab FlyBaseID:FBgn0264442 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_647774.2 Gene:BtbVII FlyBaseID:FBgn0263108 Length:907 Species:Drosophila melanogaster

Alignment Length:956 Identity:208/957 (22%)
Similarity:304/957 (32%) Gaps:323/957 (34%)


  Fly    76 QHYALKWNDFQSSILSSFRHLRDEEDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKANPCEHP 140
            |.:.|:||:.|.:.:|....|......||||||.:.|...|||:||||||.||:.|...|||:||
  Fly     4 QQFCLRWNNHQPNFISVCSSLLHNGTLVDVTLAAEGRQLQAHKIVLSACSSYFQALFTTNPCQHP 68

  Fly   141 IVILRDVRCDDVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLADVNGGYPYSKA-LSAALS 204
            ||||:||:.||::.::.|||.||||||.||||..||||.:|:|:|||::    |...| |:.:.|
  Fly    69 IVILKDVQYDDLKTMVDFMYYGEVNVSQEQLPHILKTAEMLKIKGLAEM----PTDPANLTKSDS 129

  Fly   205 HNSSNNN---------------------NNNSSSNNSL----------SNNNNNNNNNAESSNHN 238
            .:|::..                     .:.||..:||          ..........|:..:|:
  Fly   130 KSSTDGTEMVGGAGVGTGAGNSAGSLGAGSGSSVGDSLWSSSEAQQFQQQQQQQAQQQAQQQHHH 194

  Fly   239 -----------------------------------------------KISSYLSPNQTSAACNNS 256
                                                           :..|.||...:.|.....
  Fly   195 HQQQQQLQQQQQQAQQQQQQQQHHHHHHQQQQSGQAQAAQTHHHQMRRTPSPLSAGTSPATRRKR 259

  Fly   257 SNSNSNNHSSSHNNSSSNNISGSLNSSL-------NSPFSAPQIPPPVTASSAAAAAAAAASLTA 314
            ...:|||.|...||:...:     ||||       |:..|..|:.   ..:..|....|..||.|
  Fly   260 LRKSSNNGSGDRNNAEEQH-----NSSLDAGSGAGNAGLSLAQMN---QMTFGAGGGLAGHSLHA 316

  Fly   315 AVAAAAAATA-------------------------ASAGSSSSAASGQTSG--TPAIQELKAS-- 350
            |.....:|:|                         ...|..:.......||  ||:..:...|  
  Fly   317 AKLLKESASAELEQQPQDSDLDDGHGHLHMQIKPEVDIGGVNQTMPLDISGGTTPSEHDAPNSQS 381

  Fly   351 --SAASPVRNPNP--NPSKASSSNHWDMGEMEGS--------------------------RKSHL 385
              |..||...|:|  .|..|:||:....|..|.|                          |...|
  Fly   382 SHSEPSPAHAPHPPHPPLGAASSSSGGSGSFERSFSIGGVGSVECDPDGTPSSPAVMGTKRNRVL 446

  Fly   386 TPPPQKRIKSADLFRAQHGISPE--RLLLD--------------REFPVAGQHPLTRN------- 427
            |..|:.: :.:|...:.:.|||:  ...||              |::...|.|.|...       
  Fly   447 TRQPRVK-RDSDSISSTNQISPDTAATTLDFDPFNAAGATSATARDYSTTGSHHLHHQSAVHHHH 510

  Fly   428 -------RSGRDTS------------------------KDRERNLELRESLLGQALENSNGQQA- 460
                   |..|..|                        |.....|..|:|.|..|...|....| 
  Fly   511 HLLTVPPRIERHASEPAPSLAPSTPHLLSVPSSTPYLIKQHSDPLLPRQSALHMAGSGSGSSSAM 575

  Fly   461 -------NPKHELGQSAGEDSNSSDTEPSDRGDGQHDGTLDGIDNQRSHSFPNAFLGLQGIPGLL 518
                   .|.|.........||:|...|:......|....:.|....|                 
  Fly   576 ATGSNPFAPLHRQYSHPLSGSNASYVTPAPLHHPHHISLPESIYASGS----------------- 623

  Fly   519 PGPSGINSDFVSRRSLEMRV-----RATDPRPCPKCGKIYRSAHTLRT-------HLEDKHTVCP 571
            |.|:|.:...|..|.:...|     .||.....|.......:|.::.|       :...:|.:.|
  Fly   624 PPPAGSSQYLVPTRVVACPVVSSETAATPTNASPGSSSTVSAAVSVVTSPNAGLQNSASRHPLSP 688

  Fly   572 GYRCVLCGTVAKSRNSLHSHMSRQHRGISTKDLPVLPMPSAFDPELA-SRLLAKAGVKISPAE-- 633
            .:.  :...||..|.|.||                        |.:: |:::.:||.  :|||  
  Fly   689 TFS--IGSDVAHERRSPHS------------------------PSISRSQVVERAGK--NPAEAA 725

  Fly   634 ------LRARASPTG---GSGSSGGGGGGGSSQAKLDLSNASGGPMDDAEDSDDDPEDLTT---- 685
                  ||...|.:|   |:....|.....||...|.........:..:..|.....::.|    
  Fly   726 NGGGSRLRTSKSASGSITGTHLHPGQATMSSSFEHLPTLRVKNEELQRSVSSPQTQREIITLENP 790

  Fly   686 -------------------GNGLYGMGGSSSDLSRYH-ESLLSNF--------GHARMRNEAAAV 722
                               .|.:.|.|......::|| ....:|.        .|.|:.||||| 
  Fly   791 RSSHCPVIRPGPALGCNFCWNTIDGHGRILRRKTKYHCPECQTNLCIVPCFQEYHERLNNEAAA- 854

  Fly   723 AATAAALGQPKDLGVQLPNSNAPGQSLLDTYLQFITENTFGMGMSQ 768
            |::.||.|. ..|......|.:........|:.....::.|.|.::
  Fly   855 ASSGAAAGD-NQLSSSTTGSGSSSSGKASPYVSSAGSSSSGAGAAR 899

Known Domains:


GeneSequenceDomainRegion External IDIdentity
abNP_476562.1 BTB 93..189 CDD:279045 55/96 (57%)
BTB 104..189 CDD:197585 53/85 (62%)
zf-Di19 545..597 CDD:283297 11/59 (19%)
C2H2 Zn finger 546..567 CDD:275371 3/28 (11%)
C2H2 Zn finger 575..596 CDD:275371 6/21 (29%)
BtbVIINP_647774.2 BTB 24..117 CDD:279045 55/93 (59%)
BTB 32..117 CDD:197585 53/85 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000318
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23110
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.