DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and cacnb2a

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_001077037.1 Gene:cacnb2a ZFINID:ZDB-GENE-080808-7 Length:598 Species:Danio rerio

Alignment Length:619 Identity:294/620 (47%)
Similarity:356/620 (57%) Gaps:135/620 (22%)


  Fly    41 GSADSNYSQPS-SDLSLDEEKESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQ 104
            |||||..|:|| ||:||:|:||:||||.||||.:|||||:||||||||||||.|..:.:||.||.
Zfish    23 GSADSYTSRPSDSDVSLEEDKETLRREAERQAQAQLDKAKSKPVAFAVRTNVGYSASSEDDVPVP 87

  Fly   105 GGAVSFEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLDN--IRMQNQTRPSRLYGTK-- 165
            |..:||:.::|||:|||::|:||||||||||||:||||||.||::  :|.:.:.:..|.|.:|  
Zfish    88 GTGISFDPKDFLHVKEKFNNDWWIGRLVKEGCDIGFIPSPVKLESSRLRQEQRAKQGRFYSSKSG 152

  Fly   166 GSSSGNLGAGGQAGAEPSRGSTPPTPGDESDSMGPGRHGKTPAAAANKEKRKPFFKKQETASPYD 230
            .:||.:||    .....||.||||:                        ..|.:.|..|.|.|||
Zfish   153 ANSSSSLG----DIVSNSRKSTPPS------------------------SAKQWQKSTEHAPPYD 189

  Fly   231 VVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAI 295
            ||||||||||||||||||||||||||||||||||||||||.||||.|||||||||::|||||.||
Zfish   190 VVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRITITRVAADISLAKRSVLNNPSKHAI 254

  Fly   296 MERSSSRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQ 360
            :|||::||: |.:||.||||||||||:|||||||.|||||||||.||.|||.|||:||:|.||||
Zfish   255 IERSNTRSN-LAEVQSEIERIFELARTLQLVVLDADTINHPSQLGKTCLAPIIVYIKITSPKVLQ 318

  Fly   361 RLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATHPDIRA 425
            ||||||||||||:|:||||||:||||||.::||:|||||||||||||:|:|||.|||:|||    
Zfish   319 RLIKSRGKSQAKHLNVQMVAADKLAQCPSELFDIILDENQLEDACEHMADYLELYWKSTHP---- 379

  Fly   426 VPPIARPLPQEASPSADPARLGPTPPVD------------GEEFVDEQ------DPRMGMSGGDR 472
                         ||..|:    ||.:|            .|:..:.|      |.....:..||
Zfish   380 -------------PSGAPS----TPLLDKLSAVTAAAVACKEQLTNTQPKGTGSDQHADRAAADR 427

  Fly   473 ---------------------------EGSRERDRDSRERERERERERDYWDREFNRDRSSKDRE 510
                                       |...|.|.|..|...||...||..|...|:..||...|
Zfish   428 TSFYEDYHHHHHPQQQHYQTQKQESFEEEEEEEDDDEEENTDERHDNRDQQDHHKNQHSSSTRTE 492

  Fly   511 RDLEWERERAREWER-------------------ERERDWDREFDWDQGGTSYQHSRRQPTSVRH 556
            |.............|                   |.:.....:.:.:|......|.|......||
Zfish   493 RHHHHRHHHHHHHHRHHHSRTGRTLSKQETLESTETQTHSQPQQEEEQESVQPNHHRHHHHHHRH 557

  Fly   557 QERGGGVGAGGGGGGVGGGYERDRERERYERRER 590
            ..|.                |:::|.:..||..|
Zfish   558 HHRN----------------EKEKEHDHNERNSR 575

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 29/41 (71%)
SH3_CACNB 85..146 CDD:212797 40/61 (66%)
Guanylate_kin 234..415 CDD:279019 150/181 (83%)
NK 244..416 CDD:302627 141/172 (82%)
cacnb2aNP_001077037.1 VGCC_beta4Aa_N 23..64 CDD:288872 29/41 (71%)
SH3_CACNB2 63..131 CDD:212973 47/68 (69%)
Guanylate_kin 193..373 CDD:279019 150/181 (83%)
NK 203..374 CDD:302627 141/172 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52586296
eggNOG 1 0.900 E1_KOG3812
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128949
Panther 1 1.100 O PTHR11824
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.