DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and CACNB4

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_000717.2 Gene:CACNB4 HGNCID:1404 Length:520 Species:Homo sapiens

Alignment Length:549 Identity:287/550 (52%)
Similarity:358/550 (65%) Gaps:85/550 (15%)


  Fly    37 LFTQGSADSNYSQPS-SDLSLDEEKESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDD 100
            :..||||||..|:|| ||:||:|::|::|:|:|:||..||::|:||||||||:|||:|.||:|:|
Human    46 ILRQGSADSYTSRPSDSDVSLEEDREAIRQEREQQAAIQLERAKSKPVAFAVKTNVSYCGALDED 110

  Fly   101 SPVQGGAVSFEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPSRLYGTK 165
            .||...|:||:.::||||||||:|:|||||||||||::||||||.:|:|||:|.:.:..|.:|  
Human   111 VPVPSTAISFDAKDFLHIKEKYNNDWWIGRLVKEGCEIGFIPSPLRLENIRIQQEQKRGRFHG-- 173

  Fly   166 GSSSGNLGAGGQAGAEPSRGSTPPTPGDESDSMG---PGRHGKTPAAAANKEKRKPFFKKQETAS 227
            |.||||                      .|.|:|   .|....||.:.| |:|:    |..|...
Human   174 GKSSGN----------------------SSSSLGEMVSGTFRATPTSTA-KQKQ----KVTEHIP 211

  Fly   228 PYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSK 292
            |||||||||||||||||||||||||||||||||||||||:|||.||||.|||||||||::|||||
Human   212 PYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSK 276

  Fly   293 RAIMERSSSRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSK 357
            |||:|||::||. |.:||.||||||||||||||||||.||||||:||.||||||.||::|:||.|
Human   277 RAIIERSNTRSS-LAEVQSEIERIFELARSLQLVVLDADTINHPAQLIKTSLAPIIVHVKVSSPK 340

  Fly   358 VLQRLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATH-- 420
            |||||||||||||:|:|:||:|||:|||||||:|||||||||||||||||:.||||.||:|||  
Human   341 VLQRLIKSRGKSQSKHLNVQLVAADKLAQCPPEMFDVILDENQLEDACEHLGEYLEAYWRATHTT 405

  Fly   421 PDIRAVPPIARPLPQEASPSADPARLGPTPPVDGEEFVDEQDPRMGMSGGDREGSRERDRDSRER 485
            ......|.:.|.|...|        |.|.|              ..:||...:..|..:..:...
Human   406 SSTPMTPLLGRNLGSTA--------LSPYP--------------TAISGLQSQRMRHSNHSTENS 448

  Fly   486 ERERERERDYWDREFNRDRSSKDRERDLEWERERAREWERERERDWDREFDWDQGGTSYQHSRRQ 550
            ..|| |.....|..::.:|:.|.|.| |....:.:|:.....|.|:.         .|||.:.:.
Human   449 PIER-RSLMTSDENYHNERARKSRNR-LSSSSQHSRDHYPLVEEDYP---------DSYQDTYKP 502

  Fly   551 PTSVRHQERGGGVGAGGGGGGVGGGYERD 579
                 |:.||.           .|||..|
Human   503 -----HRNRGS-----------PGGYSHD 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 23/41 (56%)
SH3_CACNB 85..146 CDD:212797 42/61 (69%)
Guanylate_kin 234..415 CDD:279019 151/181 (83%)
NK 244..416 CDD:302627 142/172 (83%)
CACNB4NP_000717.2 VGCC_beta4Aa_N 50..91 CDD:314861 23/41 (56%)
SH3_CACNB4 91..158 CDD:212976 47/67 (70%)
Guanylate_kin 218..398 CDD:331880 151/181 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52542412
eggNOG 1 0.900 E1_KOG3812
Hieranoid 1 1.000
Homologene 1 1.000 H20188
Inparanoid 1 1.050 522 1.000 Inparanoid score I1243
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 1 1.000 T608611
orthoMCL 1 0.900 OOG5_128949
Panther 1 1.100 O PTHR11824
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.760

Return to query results.
Submit another query.