DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and CACNB3

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_000716.2 Gene:CACNB3 HGNCID:1403 Length:484 Species:Homo sapiens

Alignment Length:535 Identity:276/536 (51%)
Similarity:338/536 (63%) Gaps:94/536 (18%)


  Fly    29 SYQSGYNKLFTQGSADSNYSQPS--SDLSLDEEKESLRREKERQALSQLDKARSKPVAFAVRTNV 91
            ||..|:.. ...|||||..|:||  ||:||:|::||.|||.|.||..||::|:.|||||||||||
Human     5 SYVPGFED-SEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPVAFAVRTNV 68

  Fly    92 AYDGAIDDDSPVQGGAVSFEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQT 156
            :|.|.:|::.||||..|:||.::||||||||.|:||||||||||.|:.|||||.:|::||::.:.
Human    69 SYCGVLDEECPVQGSGVNFEAKDFLHIKEKYSNDWWIGRLVKEGGDIAFIPSPQRLESIRLKQEQ 133

  Fly   157 RPSRLYGTKGSSSGNLGAGGQAGAEPSRGSTPPTPGDESDSMGPGRHGKTPAAAANKEKRKPFFK 221
            :..|        |||                   |...|| :| .|....|:.|..|:      |
Human   134 KARR--------SGN-------------------PSSLSD-IG-NRRSPPPSLAKQKQ------K 163

  Fly   222 KQETASPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSI 286
            :.|...|||||||||||||||||||||||||||||||||||||||:|||.||||.||:||||||:
Human   164 QAEHVPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADLSLAKRSV 228

  Fly   287 MNNPSKRAIMERSSSRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYL 351
            :|||.||.|:||||:||. :.:||.|||||||||:||||||||.||||||:|||||||||.||::
Human   229 LNNPGKRTIIERSSARSS-IAEVQSEIERIFELAKSLQLVVLDADTINHPAQLAKTSLAPIIVFV 292

  Fly   352 KISSSKVLQRLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYW 416
            |:||.|||||||:||||||.|:|:|||:|.:||.||||:.||||||||||||||||:|||||.||
Human   293 KVSSPKVLQRLIRSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLEDACEHLAEYLEVYW 357

  Fly   417 KATHPDIRAVPPIARPLPQEASPSADPARLGPTPPVDG-------EEFVDEQDP--RMGMSGGDR 472
            :|||                 .|:..|..|||...:.|       .|..:|..|  |..:...|.
Human   358 RATH-----------------HPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDE 405

  Fly   473 --EGSRERDRDSRERERERERERDYWD---------REFN-----------RDR----SSKDRER 511
              |.||:....|.:|. .|..|.||.|         |:..           :||    .|:....
Human   406 ASESSRQAWTGSSQRS-SRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHS 469

  Fly   512 DLEWERERAREWERE 526
            |..|:|.  |.|.::
Human   470 DRNWQRN--RPWPKD 482

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 24/42 (57%)
SH3_CACNB 85..146 CDD:212797 42/61 (69%)
Guanylate_kin 234..415 CDD:279019 145/181 (80%)
NK 244..416 CDD:302627 136/172 (79%)
CACNB3NP_000716.2 VGCC_beta4Aa_N 16..58 CDD:314861 24/42 (57%)
SH3_CACNB3 58..125 CDD:212975 47/67 (70%)
Guanylate_kin 176..356 CDD:331880 145/181 (80%)
Mediates interaction with the alpha subunit. {ECO:0000250|UniProtKB:P54287} 195..345 117/151 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52569230
eggNOG 1 0.900 E1_KOG3812
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11824
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.