DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and CACNB2

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_963890.2 Gene:CACNB2 HGNCID:1402 Length:660 Species:Homo sapiens

Alignment Length:631 Identity:324/632 (51%)
Similarity:403/632 (64%) Gaps:118/632 (19%)


  Fly     5 ASSSDAPSVQGGQHRESRF--GLGYPSYQSGYNKLFTQGSADSNYSQPS-SDLSLDEEKESLRRE 66
            |..:.|.|...|..|::||  ..|..|..:..|....||||||..|:|| ||:||:|::|::|||
Human    34 ALGAAAQSYGKGARRKNRFKGSDGSTSSDTTSNSFVRQGSADSYTSRPSDSDVSLEEDREAVRRE 98

  Fly    67 KERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQGGAVSFEIREFLHIKEKYDNNWWIGRL 131
            .||||.:||:||::|||||||||||:|..|.:||.||.|.|:|||.::|||:|||::|:||||||
Human    99 AERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRL 163

  Fly   132 VKEGCDVGFIPSPAKLDNIRMQNQTR--PSRLYGTK--GSSSGNLGAGGQAGAEP-SRGSTPPTP 191
            |||||::||||||.||:|:|:|::.|  ..:.|.:|  |:||.:||     ...| ||.||||:.
Human   164 VKEGCEIGFIPSPVKLENMRLQHEQRAKQGKFYSSKSGGNSSSSLG-----DIVPSSRKSTPPSS 223

  Fly   192 GDESDSMG--------PGRHGKTPAAAAN-------KEKRKPFFKKQETASPYDVVPSMRPVVLV 241
            ..:.|:.|        |..| ::|..:||       ||||.|||||.|...||||||||||||||
Human   224 AIDIDATGLDAEENDIPANH-RSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLV 287

  Fly   242 GPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAIMERSSSRSDCL 306
            |||||||||||||||||||||||||||||.||||.|||||||||::|||||.||:|||::||. |
Human   288 GPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSS-L 351

  Fly   307 GKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQRLIKSRGKSQA 371
            .:||.||||||||||:|||||||.||||||:||:||||||.|||:||||.|||||||||||||||
Human   352 AEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQA 416

  Fly   372 KNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATHPDIRAVP--------- 427
            |:|:||||||:|||||||::||||||||||||||||:|:|||.|||||||...::|         
Human   417 KHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPSSSLPNPLLSRTLA 481

  Fly   428 ---------------------------PIARPLPQEASPSADPA----------------RLGPT 449
                                       ||......|..||.:|.                |.|.:
Human   482 TSSLPLSPTLASNSQGSQGDQRTDRSAPIRSASQAEEEPSVEPVKKSQHRSSSSAPHHNHRSGTS 546

  Fly   450 PPVDGEEFVDEQ----------DPRMGMS---------------GGDREGSRE-RDRDSRERERE 488
            ..:..:|..|.:          :|:...|               ..:..||.: |.|:||.|.|:
Human   547 RGLSRQETFDSETQESRDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDHRHRESRHRSRD 611

  Fly   489 RERERDYWDREFNRDRS---SKDR--ERD---LEWERERAREWERE 526
            .:||:|:  .|.|:.||   ||||  |:|   :..:|..|.||.|:
Human   612 VDREQDH--NECNKQRSRHKSKDRYCEKDGEVISKKRNEAGEWNRD 655

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 25/41 (61%)
SH3_CACNB 85..146 CDD:212797 42/61 (69%)
Guanylate_kin 234..415 CDD:279019 153/181 (85%)
NK 244..416 CDD:302627 144/172 (84%)
CACNB2NP_963890.2 VGCC_beta4Aa_N 72..113 CDD:288872 25/41 (61%)
SH3_CACNB2 112..180 CDD:212973 48/68 (71%)
Guanylate_kin 280..460 CDD:279019 153/181 (85%)
NK 290..461 CDD:302627 144/172 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52578255
eggNOG 1 0.900 E1_KOG3812
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 522 1.000 Inparanoid score I1243
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 1 1.000 T608611
orthoMCL 1 0.900 OOG5_128949
Panther 1 1.100 O PTHR11824
Phylome 1 0.910 0.889 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3437
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.