DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and CACNB1

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:XP_005257702.1 Gene:CACNB1 HGNCID:1401 Length:643 Species:Homo sapiens

Alignment Length:709 Identity:322/710 (45%)
Similarity:399/710 (56%) Gaps:149/710 (21%)


  Fly     1 MVQRASSSDA--------------PSVQGG-QHRESRF--GLGYPSYQSGYNKLFTQGSADSNYS 48
            |||:.|.|..              ||.||. ..|:.||  ..|..|..:..|....||||:|..|
Human     1 MVQKTSMSRGPYPPSQEIPMEVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTS 65

  Fly    49 QPS-SDLSLDEEKESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQGGAVSFEI 112
            :|| ||:||:|::|:||:|.|||||:||:||::|||||||||||.|:.:..|:.||||.|::||.
Human    66 RPSDSDVSLEEDREALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVPVQGVAITFEP 130

  Fly   113 REFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRM--QNQTRPSRLYGTK-----GSSSG 170
            ::||||||||:|:|||||||||||:|||||||.|||::|:  :.:.|.:||..:|     .||.|
Human   131 KDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNRLGSSKSGDNSSSSLG 195

  Fly   171 NLGAGGQAGAEPSRGSTPPTPGDESDSMG-------------------------------PGRHG 204
            ::..|       :|..|||..|:|..::.                               |..||
Human   196 DVVTG-------TRRPTPPASGNEMTNLAFELDPLELEEEEAELGEQSGSAKTSVSSVTTPPPHG 253

  Fly   205 KTPAAAANKEKRKPFFKKQETASPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGR 269
                      ||.|||||.|...||||||||||::|||||||||||||||||||||||||||:||
Human   254 ----------KRIPFFKKTEHVPPYDVVPSMRPIILVGPSLKGYEVTDMMQKALFDFLKHRFDGR 308

  Fly   270 IIITRVMADISLAKRSIMNNPSKRAIMERSSSRSDCLGKVQEEIERIFELARSLQLVVLDCDTIN 334
            |.||||.|||||||||::|||||..|:|||::||. |.:||.||||||||||:||||.||.||||
Human   309 ISITRVTADISLAKRSVLNNPSKHIIIERSNTRSS-LAEVQSEIERIFELARTLQLVALDADTIN 372

  Fly   335 HPSQLAKTSLAPTIVYLKISSSKVLQRLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDEN 399
            ||:||:||||||.|||:||:|.||||||||||||||:|:|:||:.|:||||||||:|||:|||||
Human   373 HPAQLSKTSLAPIIVYIKITSPKVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDEN 437

  Fly   400 QLEDACEHIAEYLETYWKATHPDIRAVP-PIARPLPQEASPSADPARLG------------PTPP 451
            ||||||||:|||||.|||||||.....| |:.......|:.:|.||.:.            |...
Human   438 QLEDACEHLAEYLEAYWKATHPPSSTPPNPLLNRTMATAALAASPAPVSNLQGPYLASGDQPLER 502

  Fly   452 VDGEE-FVDEQDPRMGMSGGDREGSRERDRDSRERERERERERDYWDREFNRDRSSKDRERDLEW 515
            ..||. .:.|....:|...|....|....|....|...|:   |.:|.:....|:|.        
Human   503 ATGEHASMHEYPGELGQPPGLYPSSHPPGRAGTLRALSRQ---DTFDADTPGSRNSA-------- 556

  Fly   516 ERERAREWERERERDWDREFDWDQGGTSYQHSRRQPTSVRHQERGGGVGAGGGGG---GVGGGYE 577
                                 :.:.|.|.......|:      .|.|:|...|||   ...|.:|
Human   557 ---------------------YTELGDSCVDMETDPS------EGPGLGDPAGGGTPPARQGSWE 594

  Fly   578 RDRERERYERRERDLMHYDLNSDELLDERN-----FEYPAMRSGPSGASHHGHLSRGGR 631
              .|.|.||             :||.|.||     ..|.|...||....:...|...||
Human   595 --DEEEDYE-------------EELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGR 638

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 25/41 (61%)
SH3_CACNB 85..146 CDD:212797 43/61 (70%)
Guanylate_kin 234..415 CDD:279019 145/181 (80%)
NK 244..416 CDD:302627 138/172 (80%)
CACNB1XP_005257702.1 VGCC_beta4Aa_N 58..99 CDD:288872 25/41 (61%)
SH3 99..166 CDD:302595 49/67 (73%)
Guanylate_kin 273..453 CDD:279019 145/181 (80%)
GuKc 283..454 CDD:214504 138/172 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52579077
eggNOG 1 0.900 E1_KOG3812
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 522 1.000 Inparanoid score I1243
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 1 1.000 T608611
orthoMCL 1 0.900 OOG5_128949
Panther 1 1.100 LDO PTHR11824
Phylome 1 0.910 0.778 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3437
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.