DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and cacnb4b

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_001106988.1 Gene:cacnb4b ZFINID:ZDB-GENE-060421-7907 Length:523 Species:Danio rerio

Alignment Length:593 Identity:289/594 (49%)
Similarity:355/594 (60%) Gaps:130/594 (22%)


  Fly    37 LFTQGSADSNYSQPS-SDLSLDEEK----ESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGA 96
            :..||||||..|:|| ||:||:||:    ...|:|:|:||..||::|::|.|||||:|||:|.||
Zfish    46 ILRQGSADSYTSRPSDSDVSLEEERPEGGSQGRQEREQQAQLQLERAKAKAVAFAVKTNVSYCGA 110

  Fly    97 IDDDSPVQGGAVSFEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPSRL 161
            :|:|.||.|.|:||:.::|||||||::|:|||||||||||::||||||.||:|||.|.:.:.||:
Zfish   111 LDEDVPVPGTAISFDAKDFLHIKEKFNNDWWIGRLVKEGCEIGFIPSPLKLENIRAQLEQKKSRV 175

  Fly   162 YG-TKGSSSGNLGAGGQAGAEPSRGSTPPTPGDESDSMGPGRHGKTPAAAANKEKRKPFFKKQET 225
            .| :.||||.:||                      |.|..|           |:|:    |..|.
Zfish   176 QGKSSGSSSSSLG----------------------DVMSSG-----------KQKQ----KVTEH 203

  Fly   226 ASPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNP 290
            .:|||||||||||||||||||||||||||||||||||||||:|||.||||.|||||||||::|||
Zfish   204 VAPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRITITRVTADISLAKRSVLNNP 268

  Fly   291 SKRAIMERSSSRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISS 355
            |||||:|||::||. |.:||.||||||||||||||||||.||||||:||.||||||.||::|:||
Zfish   269 SKRAIIERSNTRSS-LAEVQSEIERIFELARSLQLVVLDADTINHPAQLMKTSLAPIIVHVKVSS 332

  Fly   356 SKVLQRLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATH 420
            .||||||||||||||:|:|:||:|||:|||||||:|||:|||||||||||||:|||||.||||||
Zfish   333 PKVLQRLIKSRGKSQSKHLNVQLVAADKLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKATH 397

  Fly   421 PDIRAVPPIARPLPQEASPSADPARLGP--TPPVDGEEFVDEQDPRMGMSGGDREGSRERDRDSR 483
            ..      .:.||......:..||.|.|  |..:.|.:....|..|.....||.....||     
Zfish   398 TS------SSTPLNPLLGRNLGPAALAPYTTSAISGLQNQQGQKTRHANHTGDHSTPNER----- 451

  Fly   484 ERERERERERDYWDREFNRDRSSKDRERDLEWERERAREWERERERDWDREFDWDQGGTSYQHSR 548
                   |.....|..::.:|:.|.|.|                            |.:..||  
Zfish   452 -------RNLMTSDENYHNERAHKGRNR----------------------------GSSGSQH-- 479

  Fly   549 RQPTSVRHQERGGGVGAGGGGGGVGGGYERDRERERYERRERDLMHYDLNSDELLDERNFEYPAM 613
                                 ||.|..:....|::.|:         |...|.....||      
Zfish   480 ---------------------GGSGRDHHYMEEQQGYQ---------DPYQDTYKPHRN------ 508

  Fly   614 RSGPSGAS 621
            ||.|...|
Zfish   509 RSSPGSYS 516

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 22/45 (49%)
SH3_CACNB 85..146 CDD:212797 42/61 (69%)
Guanylate_kin 234..415 CDD:279019 151/181 (83%)
NK 244..416 CDD:302627 142/172 (83%)
cacnb4bNP_001106988.1 VGCC_beta4Aa_N 50..91 CDD:288872 21/41 (51%)
SH3 103..162 CDD:302595 41/59 (69%)
Guanylate_kin 212..392 CDD:279019 151/181 (83%)
NK 222..393 CDD:302627 142/172 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52588713
eggNOG 1 0.900 E1_KOG3812
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128949
Panther 1 1.100 O PTHR11824
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.