DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and Cacnb4

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:XP_017447488.1 Gene:Cacnb4 RGDID:68385 Length:519 Species:Rattus norvegicus

Alignment Length:567 Identity:294/568 (52%)
Similarity:369/568 (65%) Gaps:76/568 (13%)


  Fly     5 ASSSDAPSVQ---GGQHRESRFGLGYPSYQSGYNKLFTQGSADSNYSQPS-SDLSLDEEKESLRR 65
            |....:||.|   |...|.||......|..| .:.:..||||||..|:|| ||:||:|::|::|:
  Rat    11 ADGPHSPSSQVARGTTTRRSRLKRSDGSTTS-TSFILRQGSADSYTSRPSDSDVSLEEDREAIRQ 74

  Fly    66 EKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQGGAVSFEIREFLHIKEKYDNNWWIGR 130
            |:|:||..||::|:||||||||:|||:|.||:|:|.||...|:||:.::||||||||:|:|||||
  Rat    75 EREQQAAIQLERAKSKPVAFAVKTNVSYCGALDEDVPVPSTAISFDAKDFLHIKEKYNNDWWIGR 139

  Fly   131 LVKEGCDVGFIPSPAKLDNIRMQNQTRPSRLYGTKGSSSGNLGAGGQAGAEPSRGSTPPTPGDES 195
            ||||||::||||||.:|:|||:|.:.:..|.:|  |.||||                      .|
  Rat   140 LVKEGCEIGFIPSPLRLENIRIQQEQKRGRFHG--GKSSGN----------------------SS 180

  Fly   196 DSMG---PGRHGKTPAAAANKEKRKPFFKKQETASPYDVVPSMRPVVLVGPSLKGYEVTDMMQKA 257
            .|:|   .|....||...| |:|:    |..|...||||||||||||||||||||||||||||||
  Rat   181 SSLGEMVSGTFRATPTTTA-KQKQ----KVTEHIPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKA 240

  Fly   258 LFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAIMERSSSRSDCLGKVQEEIERIFELARS 322
            |||||||||:|||.||||.|||||||||::||||||||:|||::||. |.:||.|||||||||||
  Rat   241 LFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRSS-LAEVQSEIERIFELARS 304

  Fly   323 LQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQRLIKSRGKSQAKNLSVQMVAAEKLAQC 387
            |||||||.||||||:||.||||||.||::|:||.||||||||||||||:|:|:||:|||:|||||
  Rat   305 LQLVVLDADTINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIKSRGKSQSKHLNVQLVAADKLAQC 369

  Fly   388 PPDMFDVILDENQLEDACEHIAEYLETYWKATHPDIRAVPPIARPLPQEASPSADPARLGPTPPV 452
            ||:|||||||||||||||||:.||||.||:|||..  :..|:...|.:....:|    |.|.|  
  Rat   370 PPEMFDVILDENQLEDACEHLGEYLEAYWRATHTS--SSTPMTPLLGRNVGSTA----LSPYP-- 426

  Fly   453 DGEEFVDEQDPRMGMSGGDREGSRERDRDSRERERERERERDYWDREFNRDRSSKDRERDLEWER 517
                        ..:||...:..|..:..:.....|| |.....|..::.:|:.|.|.| |....
  Rat   427 ------------TAISGLQSQRMRHSNHSTENSPIER-RSLMTSDENYHNERARKSRNR-LSSSS 477

  Fly   518 ERAREWERERERDWDREFDWDQGGTSYQHSRRQPTSVRHQERG--GG 562
            :.:|:.....|.|:.         .|||.:.:.     |:.||  ||
  Rat   478 QHSRDHYPLVEEDYP---------DSYQDTYKP-----HRNRGSPGG 510

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 23/41 (56%)
SH3_CACNB 85..146 CDD:212797 42/61 (69%)
Guanylate_kin 234..415 CDD:279019 151/181 (83%)
NK 244..416 CDD:302627 142/172 (83%)
Cacnb4XP_017447488.1 VGCC_beta4Aa_N 49..90 CDD:288872 23/41 (56%)
SH3_CACNB4 90..157 CDD:212976 47/67 (70%)
Guanylate_kin 217..397 CDD:279019 151/181 (83%)
NK 227..398 CDD:302627 142/172 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52591974
eggNOG 1 0.900 E1_KOG3812
Hieranoid 1 1.000
Homologene 1 1.000 H20188
Inparanoid 1 1.050 514 1.000 Inparanoid score I1228
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 1 1.000 T617551
orthoMCL 1 0.900 OOG5_128949
Panther 1 1.100 O PTHR11824
Phylome 1 0.910 0.889 Consistency score
TreeFam 1 0.960
1211.760

Return to query results.
Submit another query.