DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and cacnb3a

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:XP_005162051.1 Gene:cacnb3a ZFINID:ZDB-GENE-060221-2 Length:555 Species:Danio rerio

Alignment Length:586 Identity:293/587 (50%)
Similarity:364/587 (62%) Gaps:93/587 (16%)


  Fly     1 MVQ-RASSSDAPSVQGGQ---------------HRESRFGLGYPSYQSGYNKLF--TQGSADSNY 47
            ||| :.|.|.|..:.|.:               .|:.||.....|..|.....|  .||||||..
Zfish     1 MVQVKMSKSSADPLSGVESASQSHYFQLPRKLPKRKGRFKRSDGSTSSDTTSSFIKRQGSADSYT 65

  Fly    48 SQPS-SDLSLDEEKESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQGGAVSFE 111
            |:|| ||||.:|::|:.|||.||||..||::|:||||||||:|||.|.||:|::.||||.|::||
Zfish    66 SRPSDSDLSAEEDREAYRREAERQAQLQLERAKSKPVAFAVKTNVNYCGALDEECPVQGAAINFE 130

  Fly   112 IREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPSRLYGTKGSSSGNLGAGG 176
            .::||||||||:|:||||||||||.|:.|||||.:|:.:|::.:.:..|..|...||.|::.:||
Zfish   131 AKDFLHIKEKYNNDWWIGRLVKEGADISFIPSPLRLEAMRIKQEQKQQRKSGNSSSSLGDMVSGG 195

  Fly   177 QAGAEPSRGSTPPTPGDESDSMGPGRHGKTPAAAANKEKRKPFFKKQETASPYDVVPSMRPVVLV 241
            ..       ||||:.|:                  .|:|    .|:.|...||||||||||||||
Zfish   196 WR-------STPPSAGE------------------TKQK----LKQTEHIPPYDVVPSMRPVVLV 231

  Fly   242 GPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAIMERSSSRSDCL 306
            |||||||||||||||||||||||||:|||.||||.||:||||||::|   ||.|||||::|:. |
Zfish   232 GPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADLSLAKRSVLN---KRPIMERSNTRTS-L 292

  Fly   307 GKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQRLIKSRGKSQA 371
            .:||.|||||||||::||||:||.||||||:|||||||||.|||:|::|.||||||||||||||:
Zfish   293 AEVQSEIERIFELAKTLQLVILDADTINHPAQLAKTSLAPIIVYVKVTSPKVLQRLIKSRGKSQS 357

  Fly   372 KNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATH-PDIRAVPPIARP--- 432
            |:|:|||:||:||.||||:|||||||||||||||||:|||||.||:||| |....:.|:...   
Zfish   358 KHLNVQMMAADKLTQCPPEMFDVILDENQLEDACEHLAEYLEVYWRATHLPGTTPLNPLLEQNLM 422

  Fly   433 LPQEASPSADPARLGPTPPVDG--EEFVDEQDPRMGMSGGD------REGSRERDRDSRERERER 489
            .|..|..|....:|.|.....|  ||...|||..|......      |.||........|.|.|.
Zfish   423 TPPSAISSLQNQQLSPAGGGVGVEEEEQGEQDSLMPSDEASDSRSLHRGGSSSLHPPEDEEEEEE 487

  Fly   490 ERERDYWDREF----------NRD----------RSSKDR---ERDLE------WERERAREWER 525
            |.:.||.....          ||:          ..|:||   :||.:      ..|:|:|.|.|
Zfish   488 EEDDDYQPHRHSNPYRDVYPPNRNHPGGIHSANGHESQDRLLQQRDSQDGHNQRNNRQRSRAWPR 552

  Fly   526 E 526
            :
Zfish   553 D 553

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 25/41 (61%)
SH3_CACNB 85..146 CDD:212797 42/61 (69%)
Guanylate_kin 234..415 CDD:279019 144/181 (80%)
NK 244..416 CDD:302627 135/172 (78%)
cacnb3aXP_005162051.1 VGCC_beta4Aa_N 59..100 CDD:288872 25/41 (61%)
SH3 100..167 CDD:302595 47/67 (70%)
Guanylate_kin 224..401 CDD:279019 144/181 (80%)
NK 234..402 CDD:302627 135/172 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52509204
eggNOG 1 0.900 E1_KOG3812
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128949
Panther 1 1.100 O PTHR11824
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.