DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and cacnb4a

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_001106991.1 Gene:cacnb4a ZFINID:ZDB-GENE-080320-2 Length:519 Species:Danio rerio

Alignment Length:592 Identity:294/593 (50%)
Similarity:371/593 (63%) Gaps:109/593 (18%)


  Fly    17 QHRESRFGLG----YPSYQ---SGYNK----------------LFTQGSADSNYSQPS-SDLSLD 57
            :|..:|.|:|    .|.:|   ..|::                :..||||||..|:|| ||:|||
Zfish     3 RHIYTRHGIGDGVQKPIFQVNRGTYSRRSRLKRSDGSTTSTSFILRQGSADSYTSRPSDSDVSLD 67

  Fly    58 EEKESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQGGAVSFEIREFLHIKEKY 122
            ||:.. |:|||:||..||::|::|.|||||||||:|.||:|:|.||.|.|:||:.::||||||||
Zfish    68 EEQGG-RQEKEQQATVQLERAKAKAVAFAVRTNVSYCGALDEDVPVAGTAISFDAKDFLHIKEKY 131

  Fly   123 DNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPSRLYG-TKGSSSGNLGAGGQAGAEPSRGS 186
            :|:||||||||||||:||||||.||:|||:|...:..|.:| :.|:||.:||       |...|:
Zfish   132 NNDWWIGRLVKEGCDIGFIPSPLKLENIRLQQDQKRGRFHGKSSGNSSSSLG-------EMVSGT 189

  Fly   187 TPPTPGDESDSMGPGRHGKTPAAAANKEKRKPFFKKQETASPYDVVPSMRPVVLVGPSLKGYEVT 251
            ..|.|                 |:|.|:|:    |..|...||||||||||||||||||||||||
Zfish   190 FKPNP-----------------ASAGKQKQ----KVAEHIPPYDVVPSMRPVVLVGPSLKGYEVT 233

  Fly   252 DMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAIMERSSSRSDCLGKVQEEIERI 316
            |||||||||||||||||||.||||.|||||||||::||||||||:|||::||: |.:||.|||||
Zfish   234 DMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRSN-LAEVQSEIERI 297

  Fly   317 FELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQRLIKSRGKSQAKNLSVQMVAA 381
            |||||||||||||.||||||:||.||||||.||::|:||.||||||||||||||:|:|:||:|||
Zfish   298 FELARSLQLVVLDADTINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIKSRGKSQSKHLNVQLVAA 362

  Fly   382 EKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATHPDIRAV--PPIARPLPQEASPSADPA 444
            :|||||||:|||:|||||||||||||::||||.||:|||..:...  |.:.|.|...|       
Zfish   363 DKLAQCPPEMFDIILDENQLEDACEHLSEYLEAYWRATHTSLSTPLNPLLGRNLGSTA------- 420

  Fly   445 RLGPTP-PVDGEEFVDEQDPRMGMSGGDREGSRERDRDSRERERERERERDYWDREFNRDRSSKD 508
             |.|.| .:.|.:           |..::..:...|....||......:.:|    .|.:|..|.
Zfish   421 -LSPYPTAISGLQ-----------SQRNKNSNHITDNSPMERRSLMTSDENY----HNNERQKKT 469

  Fly   509 RERDLEWERERAREWERERERDWDREFDWDQGGTSYQHSRRQPTSVR-HQERGGGVGAGGGGGGV 572
            ..| |....:::|:.....|.|:...:               |.:.: |:.||.           
Zfish   470 HNR-LSSSSQQSRDHYPLVEEDYHDPY---------------PDAYKPHRNRGS----------- 507

  Fly   573 GGGYERD 579
            .|||..|
Zfish   508 PGGYSND 514

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 24/41 (59%)
SH3_CACNB 85..146 CDD:212797 45/61 (74%)
Guanylate_kin 234..415 CDD:279019 151/181 (83%)
NK 244..416 CDD:302627 142/172 (83%)
cacnb4aNP_001106991.1 VGCC_beta4Aa_N 50..86 CDD:288872 23/37 (62%)
SH3 97..157 CDD:302595 44/60 (73%)
Guanylate_kin 216..396 CDD:279019 151/181 (83%)
NK 226..397 CDD:302627 142/172 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52529979
eggNOG 1 0.900 E1_KOG3812
Hieranoid 1 1.000
Homologene 1 1.000 H20188
Inparanoid 1 1.050 507 1.000 Inparanoid score I1266
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128949
Panther 1 1.100 O PTHR11824
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.760

Return to query results.
Submit another query.