DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and cacnb3b

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:XP_021325664.1 Gene:cacnb3b ZFINID:ZDB-GENE-090127-1 Length:389 Species:Danio rerio

Alignment Length:427 Identity:255/428 (60%)
Similarity:316/428 (74%) Gaps:52/428 (12%)


  Fly    37 LFTQGSADSNYSQPS-SDLSLDEEKESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDD 100
            |..:.||||..|:|| |||||:|:||:.|||.|||||.||::|::|||||||||||:|.||:|:|
Zfish    11 LSCKSSADSYTSRPSDSDLSLEEDKEASRREAERQALLQLERAKTKPVAFAVRTNVSYCGALDED 75

  Fly   101 SPVQGGAVSFEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPSRLYGTK 165
            .||||.|::||.::||||||||:|:||||||||||.|:.|||||.||:.:|::.:.:.::     
Zfish    76 CPVQGAAINFETKDFLHIKEKYNNDWWIGRLVKEGADIAFIPSPVKLEAMRIKQEQKAAQ----- 135

  Fly   166 GSSSGNLGAGGQAGAEPSRGSTPPTPGDESDSMGPGRHGKTPAAAANKEKRKPFFKKQETASPYD 230
             ...||..:||..       ||||                    :|.|:|:    |:.|...|||
Zfish   136 -RKMGNASSGGWR-------STPP--------------------SAAKQKQ----KQTEHVPPYD 168

  Fly   231 VVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAI 295
            ||||||||||||||||||||||||||||||||||||:|||.||||.||:||||||::|   |:||
Zfish   169 VVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADLSLAKRSVLN---KKAI 230

  Fly   296 MERSSSRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQ 360
            ||||::||. |.:||.|||||||||:||||||||.||||||:||.||||||.|||:|:||.||||
Zfish   231 MERSNTRSS-LAEVQSEIERIFELAKSLQLVVLDADTINHPAQLLKTSLAPIIVYVKVSSPKVLQ 294

  Fly   361 RLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATHPDIRA 425
            ||||||||||:|:|:|||:|.:|||||||:|||||||||||||||||:||||:.||:|||     
Zfish   295 RLIKSRGKSQSKHLNVQMMAGDKLAQCPPEMFDVILDENQLEDACEHLAEYLDIYWRATH----- 354

  Fly   426 VPPIARPLPQEASPSADPARLGPTPPVDGEEFVDEQD 462
             .|.:.||    :|..:...:.|......::|.:.|:
Zfish   355 -LPGSAPL----NPLVEQNVVTPPSANSSQQFSETQE 386

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 26/41 (63%)
SH3_CACNB 85..146 CDD:212797 44/61 (72%)
Guanylate_kin 234..415 CDD:279019 146/181 (81%)
NK 244..416 CDD:302627 137/172 (80%)
cacnb3bXP_021325664.1 VGCC_beta4Aa_N 16..56 CDD:314861 26/40 (65%)
SH3 56..123 CDD:327375 50/67 (75%)
Guanylate_kin 172..349 CDD:331880 146/181 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52546631
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11824
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.