DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and cacnb2b

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_001075217.2 Gene:cacnb2b ZFINID:ZDB-GENE-050208-129 Length:449 Species:Danio rerio

Alignment Length:400 Identity:227/400 (57%)
Similarity:277/400 (69%) Gaps:41/400 (10%)


  Fly    55 SLDEEKESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQGGAVSFEIREFLHIK 119
            |.|.:......|||:.|..|||||:.||||||||||..|..|.||:.|:.|..||||.::|||||
Zfish    18 SADRQDTGATEEKEKNAQVQLDKAKYKPVAFAVRTNFTYTPADDDNVPIPGHGVSFEAKDFLHIK 82

  Fly   120 EKYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQT---RPSRLYGTKGSSSGNLGAGGQAGAE 181
            ||::|:|||||.||||.:|||||||..|:.|.::.:.   :.::....|.:|:.......:..|.
Zfish    83 EKFNNDWWIGRPVKEGGEVGFIPSPVNLETILIRREVQARKAAKALANKAASAAKDDLNAKKAAP 147

  Fly   182 PSRGSTPPTPGDESDSMGPGRHGKTPAAAANKEKRKPFFKKQETASPYDVVPSMRPVVLVGPSLK 246
            |.                          ...:.|:    |..|..:.||||||||||||:|||||
Zfish   148 PQ--------------------------TVQQVKK----KSGEQLAAYDVVPSMRPVVLMGPSLK 182

  Fly   247 GYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAIMERSSSRSDCLGKVQE 311
            ||||||||||||||:|||||||||.||||.|||:||||||:|||||.|||:||::|:: |.::|.
Zfish   183 GYEVTDMMQKALFDYLKHRFEGRITITRVTADIALAKRSILNNPSKHAIMDRSNTRTN-LAQIQG 246

  Fly   312 EIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQRLIKSRGKSQAKNLSV 376
            |:||||||||||||||||.||||||.||:||||||.:||:||||.|||.||||:|||||.|:|:|
Zfish   247 EVERIFELARSLQLVVLDADTINHPLQLSKTSLAPILVYVKISSPKVLTRLIKTRGKSQTKHLNV 311

  Fly   377 QMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATHPDIRAVP-PIARPLPQEASPS 440
            |||||:||||||.:|||||||||||.|||||||:|||.||:||||.....| |:...|.:...|:
Zfish   312 QMVAADKLAQCPNEMFDVILDENQLSDACEHIADYLEAYWRATHPPEMEPPNPMLEKLAENTLPT 376

  Fly   441 ADPARLGPTP 450
            :      |||
Zfish   377 S------PTP 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 11/26 (42%)
SH3_CACNB 85..146 CDD:212797 40/61 (66%)
Guanylate_kin 234..415 CDD:279019 145/181 (80%)
NK 244..416 CDD:302627 137/172 (80%)
cacnb2bNP_001075217.2 SH3 44..111 CDD:302595 45/67 (67%)
Guanylate_kin 170..350 CDD:279019 145/181 (80%)
NK 180..351 CDD:302627 137/172 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52525972
eggNOG 1 0.900 E1_KOG3812
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11824
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.