DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and Cacnb1

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:XP_006247471.1 Gene:Cacnb1 RGDID:68382 Length:642 Species:Rattus norvegicus

Alignment Length:658 Identity:322/659 (49%)
Similarity:401/659 (61%) Gaps:105/659 (16%)


  Fly     1 MVQRASSSDA--------------PSVQGG-QHRESRF--GLGYPSYQSGYNKLFTQGSADSNYS 48
            |||::..|..              ||.||. ..|:.||  ..|..|..:..|....||||:|..|
  Rat     1 MVQKSGMSRGPYPPSQEIPMEVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTS 65

  Fly    49 QPS-SDLSLDEEKESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQGGAVSFEI 112
            :|| ||:||:|::|:||:|.|||||:||:||::|||||||||||.|:.:..|:.||||.|::||.
  Rat    66 RPSDSDVSLEEDREALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVPVQGVAITFEP 130

  Fly   113 REFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLDNIR-MQNQT-RPSRLYGTK-----GSSSG 170
            ::||||||||:|:|||||||||||:|||||||.|||::| :|.|| |.:||..:|     .||.|
  Rat   131 KDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQTLRQNRLSSSKSGDNSSSSLG 195

  Fly   171 NLGAGGQAGAEPSRGSTPPTPGDESDS----MGP----------GRHG---KTPAAAANKE---- 214
            ::..|       :|..|||..|:|..:    :.|          |.||   ||..::....    
  Rat   196 DVVTG-------TRRPTPPASGNEMTNFAFELDPLELEEEEAELGEHGGSAKTSVSSVTTPPPHG 253

  Fly   215 KRKPFFKKQETASPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADI 279
            ||.|||||.|...||||||||||::|||||||||||||||||||||||||||:|||.||||.|||
  Rat   254 KRIPFFKKTEHVPPYDVVPSMRPIILVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADI 318

  Fly   280 SLAKRSIMNNPSKRAIMERSSSRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSL 344
            ||||||::|||||..|:|||::||. |.:||.||||||||||:||||.||.||||||:||:||||
  Rat   319 SLAKRSVLNNPSKHIIIERSNTRSS-LAEVQSEIERIFELARTLQLVALDADTINHPAQLSKTSL 382

  Fly   345 APTIVYLKISSSKVLQRLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIA 409
            ||.|||:||:|.||||||||||||||:|:|:||:.|:||||||||:|||:|||||||||||||:|
  Rat   383 APIIVYIKITSPKVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACEHLA 447

  Fly   410 EYLETYWKATHPDIRAVP-PIARPLPQEASPSADPARL----GP-----TPPVD---GEE-FVDE 460
            ||||.|||||||.....| |:.......|:.:|.||.:    ||     ..|:|   ||. .|.|
  Rat   448 EYLEAYWKATHPPSSTPPNPLLNRTMATAALAASPAPVSNLQGPYLASGDQPLDRATGEHASVHE 512

  Fly   461 QDPRMGMSGGDREGSRERDRDSRERERERERERDYWDREFNRDRSSKDRER-----DLEWERER- 519
            ....:|...|....:....|....|...|:   |.:|.:....|:|...|.     |:|.:... 
  Rat   513 YPGELGQPPGLYPSNHPPGRAGTLRALSRQ---DTFDADTPGSRNSAYTEPGDSCVDMETDPSEG 574

  Fly   520 -------------AREWERERERDWDREFDWDQGGTSYQHSRRQPTSVRHQERGGGVGAG----- 566
                         ||:...|.|.|::.|..        .:..|.....|:...|||...|     
  Rat   575 PGPGDPAGGGTPPARQGSWEEEEDYEEEMT--------DNRNRGRNKARYCAEGGGPVLGRNKNE 631

  Fly   567 --GGGGGV 572
              |.|.||
  Rat   632 LEGWGQGV 639

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 25/41 (61%)
SH3_CACNB 85..146 CDD:212797 43/61 (70%)
Guanylate_kin 234..415 CDD:279019 145/181 (80%)
NK 244..416 CDD:302627 138/172 (80%)
Cacnb1XP_006247471.1 VGCC_beta4Aa_N 58..99 CDD:314861 25/41 (61%)
SH3 99..166 CDD:327375 49/67 (73%)
Guanylate_kin 273..453 CDD:331880 145/181 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52517733
eggNOG 1 0.900 E1_KOG3812
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 514 1.000 Inparanoid score I1228
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 1 1.000 T617551
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11824
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.980

Return to query results.
Submit another query.