| Sequence 1: | NP_001260375.1 | Gene: | Ca-beta / 34557 | FlyBaseID: | FBgn0259822 | Length: | 844 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005163864.2 | Gene: | cacnb1 / 436925 | ZFINID: | ZDB-GENE-040718-399 | Length: | 645 | Species: | Danio rerio |
| Alignment Length: | 660 | Identity: | 326/660 - (49%) |
|---|---|---|---|
| Similarity: | 398/660 - (60%) | Gaps: | 93/660 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MVQRASSSDAPSV-----------QGGQH-------RESRF--GLGYPSYQSGYNKLFTQGSADS 45
Fly 46 NYSQPS-SDLSLDEEKESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQGGAVS 109
Fly 110 FEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLDNIR--MQNQTRPSRLYGTKGSSSGNL 172
Fly 173 GAGGQAGAEPSRGSTPPTP------------------------GDESDSMGPGRHGKTPAAAANK 213
Fly 214 EKRKPFFKKQETASPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMAD 278
Fly 279 ISLAKRSIMNNPSKRAIMERSSSRS--DCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAK 341
Fly 342 TSLAPTIVYLKISSSKVLQRLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACE 406
Fly 407 HIAEYLETYWKATHPDIRAVP-PIARPLPQEASPSADPARLGPTPPVDGEEFV-DEQDPRMGMSG 469
Fly 470 G------DREGSRERDRDSRERERERER---ERDYWDREFNRDRSS---KDRERDLEWERERARE 522
Fly 523 WERERERDWDREFDW-DQGGTSYQHSRRQ--PTSVRHQERGGG-------VGAGGGGGGVGGGYE 577
Fly 578 RDRERERYER 587 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ca-beta | NP_001260375.1 | VGCC_beta4Aa_N | 41..81 | CDD:288872 | 24/40 (60%) |
| SH3_CACNB | 85..146 | CDD:212797 | 45/60 (75%) | ||
| Guanylate_kin | 234..415 | CDD:279019 | 151/182 (83%) | ||
| NK | 244..416 | CDD:302627 | 143/173 (83%) | ||
| cacnb1 | XP_005163864.2 | VGCC_beta4Aa_N | 61..102 | CDD:288872 | 24/40 (60%) |
| SH3_CACNB1 | 102..169 | CDD:212974 | 50/66 (76%) | ||
| Guanylate_kin | 270..453 | CDD:279019 | 151/182 (83%) | ||
| NK | 280..454 | CDD:302627 | 143/173 (83%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170579982 | |
| Domainoid | 1 | 1.000 | 298 | 1.000 | Domainoid score | I1418 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 515 | 1.000 | Inparanoid score | I1258 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000994 | |
| OrthoInspector | 1 | 1.000 | - | - | otm24806 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_105007 | |
| Panther | 1 | 1.100 | - | - | O | PTHR11824 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3437 |
| SonicParanoid | 1 | 1.000 | - | - | X1029 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 11 | 10.920 | |||||