DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and cacnb1

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:XP_005163864.2 Gene:cacnb1 ZFINID:ZDB-GENE-040718-399 Length:645 Species:Danio rerio

Alignment Length:660 Identity:326/661 (49%)
Similarity:398/661 (60%) Gaps:93/661 (14%)


  Fly     1 MVQRASSSDAPSV-----------QGGQH-------RESRF--GLGYPSYQSGYNKLFTQGSADS 45
            |||..:.|..||.           ..|.|       |:|||  ..|..|..:..|....||||||
Zfish     1 MVQEGNMSRTPSTSTQEIQMDMFDHHGSHAQGKYAKRKSRFKRSDGSTSSDTTSNSFVRQGSADS 65

  Fly    46 NYSQPS-SDLSLDEEKESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQGGAVS 109
            ..|:|| ||:||:|:.|:||:|.:||||:.|:||::|||||||||||.|:...:||.||||.|:|
Zfish    66 YTSRPSDSDVSLEEDPEALRKEADRQALATLEKAKTKPVAFAVRTNVGYNPGPNDDVPVQGMAIS 130

  Fly   110 FEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLDNIR--MQNQTRPSRLYGTKGSSSGNL 172
            ||.::||||||||:|:|||||||||||:|||||||.||::.|  .:.:.|.:||..:|       
Zfish   131 FEPKDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLESTRQLQEQRMRQNRLSSSK------- 188

  Fly   173 GAGGQAGAEPSRGSTPPTP------------------------GDESDSMGPGRHGKTPAAAANK 213
             :||.:..:.:.|:..|||                        .|..|..|.|  |...:...|.
Zfish   189 -SGGSSSLDVATGARRPTPPGTADLSSGLYDDALDSDVEEAETADTRDHKGVG--GSVTSPQGNL 250

  Fly   214 EKRKPFFKKQETASPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMAD 278
             .|.|||||.|...||||||||||::|||||||||||||||||||||||||:|||||.||||.||
Zfish   251 -PRLPFFKKMEHVPPYDVVPSMRPIILVGPSLKGYEVTDMMQKALFDFLKHKFEGRISITRVTAD 314

  Fly   279 ISLAKRSIMNNPSKRAIMERSSSRS--DCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAK 341
            |||||||::|||||..|:||||:||  |.|.:||.||||||||||:||||.||.|||||||||||
Zfish   315 ISLAKRSVLNNPSKHTIIERSSTRSSLDLLAEVQSEIERIFELARTLQLVALDADTINHPSQLAK 379

  Fly   342 TSLAPTIVYLKISSSKVLQRLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACE 406
            |||||.|||:||:|.||||||||||||||||:|:||||||:|||||||::||:||||||||||||
Zfish   380 TSLAPIIVYIKIASPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDIILDENQLEDACE 444

  Fly   407 HIAEYLETYWKATHPDIRAVP-PIARPLPQEASPSADPARLGPTPPVDGEEFV-DEQDPRMGMSG 469
            |:|||||.|||||||.....| |:.......|:.:|.|.   |...:.|...| .||...|...|
Zfish   445 HLAEYLEAYWKATHPPSSNPPNPLLNRTMATAALAASPE---PVSNLQGPFLVHGEQKREMPERG 506

  Fly   470 G------DREGSRERDRDSRERERERER---ERDYWDREFNRDRSS---KDRERDLEWERERARE 522
            |      |..| ::..|.||.:.:...|   .:|.:|.|....|.|   .|.|.|...|.:..|.
Zfish   507 GLQDYQSDLSG-KQPLRSSRSQLQTGSRGLSRQDTFDSETQGSRDSAYTDDMETDPYEEPDPCRS 570

  Fly   523 WERERERDWDREFDW-DQGGTSYQHSRRQ--PTSVRHQERGGG-------VGAGGGGGGVGGGYE 577
            :.........|:..| |:|....|.:...  |.:.:|| ||.|       ..|..||...|    
Zfish   571 YRLNPAHHAPRQASWEDEGAEPDQENLNMVPPPANQHQ-RGRGKLRERYCQDAEAGGATTG---- 630

  Fly   578 RDRERERYER 587
            |:..:|.:.|
Zfish   631 RNHNQEEWSR 640

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 24/41 (59%)
SH3_CACNB 85..146 CDD:212797 45/61 (74%)
Guanylate_kin 234..415 CDD:279019 151/183 (83%)
NK 244..416 CDD:302627 144/174 (83%)
cacnb1XP_005163864.2 VGCC_beta4Aa_N 61..102 CDD:288872 24/41 (59%)
SH3_CACNB1 102..169 CDD:212974 51/67 (76%)
Guanylate_kin 270..453 CDD:279019 151/183 (83%)
NK 280..454 CDD:302627 144/174 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52591376
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 507 1.000 Inparanoid score I1266
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 1 1.000 T596145
orthoMCL 1 0.900 OOG5_128949
Panther 1 1.100 LDO PTHR11824
Phylome 1 0.910 0.778 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3437
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.