DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and Cacnb3

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:XP_017450162.1 Gene:Cacnb3 RGDID:2248 Length:495 Species:Rattus norvegicus

Alignment Length:529 Identity:273/530 (52%)
Similarity:337/530 (64%) Gaps:95/530 (18%)


  Fly    40 QGSADSNYSQPS--SDLSLDEEKESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSP 102
            :|||||..|:||  ||:||:|::||.|||.|.||..||::|:.|||||||||||:|.|.:|::.|
  Rat    26 EGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPVAFAVRTNVSYCGVLDEECP 90

  Fly   103 VQGGAVSFEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPSRLYGTKGS 167
            |||..|:||.::||||||||.|:||||||||||.|:.|||||.:|::||::.:.:..|       
  Rat    91 VQGSGVNFEAKDFLHIKEKYSNDWWIGRLVKEGGDIAFIPSPQRLESIRLKQEQKARR------- 148

  Fly   168 SSGNLGAGGQAGAEPSRGSTPPTPGDESDSMGPGRHGKTPAAAANKEKRKPFFKKQETASPYDVV 232
             |||                   |...|| :| .|....|:.|..|:      |:.|...|||||
  Rat   149 -SGN-------------------PSSLSD-IG-NRRSPPPSLAKQKQ------KQAEHVPPYDVV 185

  Fly   233 PSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAIME 297
            ||||||||||||||||||||||||||||||||||:|||.||||.||:||||||::|||.||.|:|
  Rat   186 PSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADLSLAKRSVLNNPGKRTIIE 250

  Fly   298 RSSSRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQRL 362
            |||:||. :.:||.|||||||||:||||||||.||||||:|||||||||.||::|:||.||||||
  Rat   251 RSSARSS-IAEVQSEIERIFELAKSLQLVVLDADTINHPAQLAKTSLAPIIVFVKVSSPKVLQRL 314

  Fly   363 IKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATHPDIRAVP 427
            |:||||||.|:|:|||:|.:||.||||:.||||||||||:|||||:|||||.||:|||       
  Rat   315 IRSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLDDACEHLAEYLEVYWRATH------- 372

  Fly   428 PIARPLPQEASPSADPARLGPTPPVDG-------EEFVDEQDP--RMGMSGGDR--EGSRERDRD 481
                      .|:..|..|||...:.|       .|..:|..|  |..:...|.  |.||:....
  Rat   373 ----------HPAPGPGMLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTG 427

  Fly   482 SRERERERERERDYWDR-----EFNRDRSS----------------KDRERDLEWERERAREWER 525
            |.:|. .|..|.||.|.     :.:|..:|                :|.|.|     ...|.|  
  Rat   428 SSQRS-SRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHD-----HNDRNW-- 484

  Fly   526 ERERDWDRE 534
            :|.|.|.::
  Rat   485 QRNRPWPKD 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 24/42 (57%)
SH3_CACNB 85..146 CDD:212797 42/61 (69%)
Guanylate_kin 234..415 CDD:279019 144/181 (80%)
NK 244..416 CDD:302627 135/172 (78%)
Cacnb3XP_017450162.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52505922
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 1 1.000 T617551
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11824
Phylome 1 0.910 0.889 Consistency score
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.