DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and ccb-2

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_001293380.1 Gene:ccb-2 WormBaseID:WBGene00021125 Length:396 Species:Caenorhabditis elegans

Alignment Length:397 Identity:97/398 (24%)
Similarity:180/398 (45%) Gaps:84/398 (21%)


  Fly    46 NYSQPSSDLSLDEEKESLRREKERQ------ALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQ 104
            :|...|::..:.....|.|.::.|:      ||..|..::.|.|||||:....|||::|:.||::
 Worm    54 SYKLSSNEPGIKLMHNSQRDDQHRKDVEHFAALRALQHSKRKHVAFAVQAMRDYDGSLDEKSPLK 118

  Fly   105 GGAVSFEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPSRLYGTKGSSS 169
            ...:||...:|:||..|::::|||||:|:...:.||:|:..:|.|..:.::              
 Worm   119 DHTISFNTNDFIHIHTKFNSDWWIGRIVRSHSEFGFVPTARRLANYMVSDE-------------- 169

  Fly   170 GNLGAGGQAGAEPSRGSTPPTPGDESDSMGPGRHGKTPAAAANKEKRKPFFKKQETASPYDVVPS 234
                             .||...:.||                .:.|..:    |...||.||||
 Worm   170 -----------------DPPVKHNTSD----------------HQDRSIW----EPKCPYKVVPS 197

  Fly   235 MRPVVLVGPSLKGYEVTDMMQKAL-FDFLKHRFEGRIIITRVMADISLAKRSIMNNPSK--RAIM 296
            .||:||:||:|:...:|.::..|| .:.|||..:.   :..|.:||...::|.....::  |.:.
 Worm   198 SRPIVLLGPTLQHSRLTQLLHLALREEILKHFGKN---MKYVKSDIGSGQQSGDRKGARWLRGLR 259

  Fly   297 ERSSSRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQR 361
            :....:.:     .:|:|.|..:...|.|:::|...|:.|..:....|:|....:::|.:|:|.:
 Worm   260 DYDRGQDE-----NQEVELIMRMTSKLHLLLVDSPHIHTPDDVQHLPLSPIFFLIRVSDNKILAK 319

  Fly   362 LIKSRGKSQAKNLSVQMVAAEKLAQCPPDM-------------FDVILDENQLEDACEHIAEYLE 413
            |:::.|.::   ::.::..|..|.....|.             |:::::||.|.:|...|..|||
 Worm   320 LLRNTGTTR---MAAEIEVANVLKTMNDDRVGGHDDEQLIARGFEMVIEENGLREATRRIISYLE 381

  Fly   414 TYWKATH 420
            .|..|.|
 Worm   382 KYIHALH 388

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 8/41 (20%)
SH3_CACNB 85..146 CDD:212797 24/61 (39%)
Guanylate_kin 234..415 CDD:279019 46/197 (23%)
NK 244..416 CDD:302627 40/188 (21%)
ccb-2NP_001293380.1 SH3_CACNB 99..160 CDD:212797 24/61 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49916008
eggNOG 1 0.900 E1_KOG3812
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11824
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.890

Return to query results.
Submit another query.