DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and ccb-1

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_491193.2 Gene:ccb-1 WormBaseID:WBGene00000368 Length:526 Species:Caenorhabditis elegans

Alignment Length:427 Identity:270/428 (63%)
Similarity:328/428 (77%) Gaps:21/428 (5%)


  Fly    40 QGSADSNYSQPSSDLSLDE-EKESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPV 103
            :||.|||:|. ..:|.|:. .:|:|||:.||||..||::|:.|||||||.|||.|||::||||||
 Worm     6 RGSGDSNFSH-HDELELEAGNRETLRRDAERQAALQLERAKYKPVAFAVCTNVEYDGSVDDDSPV 69

  Fly   104 QGGAVSFEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPSRLYGTKGSS 168
            .|.||||::::||||||||:|:||||||||||.|:||||||.||:::|  .||..|..: .:.:|
 Worm    70 HGCAVSFKVKDFLHIKEKYNNDWWIGRLVKEGHDLGFIPSPVKLESLR--QQTAKSGKF-KQSTS 131

  Fly   169 SGNLGA-GGQAGAEPSRGSTPPTPGDESDSMGPGRHGKTPAAAANKEKRKPFFKK--QETASPYD 230
            :.|||| ........|||||||||.|  |.....:..........|||:|..|||  ||...|||
 Worm   132 ATNLGALDNMMPRSGSRGSTPPTPDD--DEYNAKKMTNIVTTPPTKEKKKLIFKKVQQENVPPYD 194

  Fly   231 VVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAI 295
            |||||||||||||||||||||||||||:||:||||||||||||||.|||||||||::|||:|||:
 Worm   195 VVPSMRPVVLVGPSLKGYEVTDMMQKAVFDYLKHRFEGRIIITRVTADISLAKRSLLNNPNKRAM 259

  Fly   296 MERSSSR-SDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVL 359
            |||::|| |:.|.::|.|||||||||||:|||||||||||||||||||||||..||:||||.|||
 Worm   260 MERANSRTSNSLAEIQTEIERIFELARSMQLVVLDCDTINHPSQLAKTSLAPIHVYIKISSPKVL 324

  Fly   360 QRLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATHPDIR 424
            |||||||||||::|::||||||||||||..::|||:||||||||||||:|:::|.||:||||.:|
 Worm   325 QRLIKSRGKSQSRNMNVQMVAAEKLAQCQAELFDVLLDENQLEDACEHLADFMEAYWRATHPPVR 389

  Fly   425 AVPPIARPLPQEASPSA--DPARL--------GPTPP 451
            :.|.|.|...:...||.  .||::        |..||
 Worm   390 SPPRIKRNPMENRGPSTLFTPAQMMQGFQGNAGQLPP 426

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 19/41 (46%)
SH3_CACNB 85..146 CDD:212797 46/61 (75%)
Guanylate_kin 234..415 CDD:279019 147/182 (81%)
NK 244..416 CDD:302627 138/173 (80%)
ccb-1NP_491193.2 VGCC_beta4Aa_N 7..47 CDD:288872 19/41 (46%)
SH3_CACNB 51..112 CDD:212797 46/61 (75%)
Guanylate_kin 198..380 CDD:279019 147/182 (81%)
NK 208..381 CDD:302627 138/173 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3812
Hieranoid 1 1.000
Homologene 1 1.000 H20188
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 1 1.000 T475449
orthoMCL 1 0.900 OOG5_128949
Panther 1 1.100 LDO PTHR11824
Phylome 1 0.910 0.938 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3437
TreeFam 1 0.960
1110.810

Return to query results.
Submit another query.